KEGG   Hafnia alvei: AT03_20625Help
Entry
AT03_20625        CDS       T03425                                 

Gene name
hslO
Definition
(GenBank) Hsp33-like chaperonin
  KO
K04083  molecular chaperone Hsp33
Organism
hav  Hafnia alvei
Brite
KEGG Orthology (KO) [BR:hav00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hav03110]
    AT03_20625 (hslO)
Chaperones and folding catalysts [BR:hav03110]
 Heat shock proteins
  HSP33
   AT03_20625 (hslO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33
Motif
Other DBs
NCBI-ProteinID: AIU74569
UniProt: A0A097R775
LinkDB All DBs
Position
4506289..4507170
Genome map
AA seq 293 aa AA seqDB search
MSNHDQLHRYLFENMAVRGELVTASHTFQQMLENHSYPAPVQTLLGELLVATSLLTATLK
FDGDITIQLQGDGPLKMAVINGNNQQEMRGVARLQGDIAEGSSMREMLGNAVMVITITPS
EGERYQGVVGLEGETLAECLEAYFMQSEQLPTRLFIRTGEHDGNACAAGMLLQIIPAQPN
NVEDLSHLAQLTTTVKSEELFGLPANEVLYRLYHQEEVTLYEPQDVTFRCTCSRERSASA
LLTVPVEELNHMLEEDGNIDMHCDYCGNHYVFDKIDIESLLAGGQNHNDECVH
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgtctaatcacgaccaattacatcgctatctgtttgaaaatatggccgttcgcggcgag
ctggtcaccgccagccacactttccagcagatgctcgaaaaccacagctatccggcaccg
gtacaaacgctgctgggcgaactgttggttgccactagccttctgaccgctacgctgaaa
tttgacggtgacatcaccattcagcttcagggcgatggtccattgaaaatggccgtcatc
aacggtaacaaccagcaggaaatgcgcggcgttgcacgtttgcagggcgatattgccgaa
ggcagtagcatgcgtgaaatgttaggtaatgcggtgatggttatcaccatcacaccaagc
gaaggcgaacgttatcaaggcgtcgtaggtctggaaggtgaaacgctggctgaatgctta
gaagcctatttcatgcagtccgaacagttgccaacccgtttgttcatccgtaccggtgag
catgatggcaatgcatgtgcagcaggtatgctgttgcaaatcatacctgcacagcctaat
aacgtggaagatttgtcgcatctggctcagttgaccacgacggtaaaatccgaagagctg
tttggtcttccagcgaacgaagtgctttatcgtctttatcatcaggaagaagtcaccctg
tatgagccacaagacgtcactttccgctgcacctgttcacgtgagcgtagcgccagcgca
ctgctgaccgttccggtggaagagctgaaccacatgttagaagaagatggcaacatcgat
atgcactgtgattactgcggtaaccactatgtatttgataaaattgatatcgaatcatta
ctggcaggtggacaaaaccacaacgacgagtgcgttcattaa

DBGET integrated database retrieval system