KEGG   Hafnia alvei: AT03_20770Help
Entry
AT03_20770        CDS       T03425                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
hav  Hafnia alvei
Pathway
hav00564  Glycerophospholipid metabolism
hav01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AT03_20770 (glpD)
Enzymes [BR:hav01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AT03_20770 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 Pyr_redox_2 3HCDH_N NAD_binding_8 FAD_oxidored Lycopene_cycl GIDA
Motif
Other DBs
NCBI-ProteinID: AIU74595
UniProt: A0A097R794
LinkDB All DBs
Position
complement(4546475..4547959)
Genome map
AA seq 494 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEAKDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKLAPHIAFPMRFRLPHQPHLRPAWMIRTGLFLYDHLGKRTSLPSS
KGLRFGPESVLKSSLTRGFEYSDCWVDDARLVLLNAQEVVVRGGEVRTRTQVTRAYRENG
LWVVEAKNADTGEVFTWRAKGLVNATGPWVKHFFDNGLELKSPYGIRLIKGSHIVVPRVH
NQPQAYILQNEDHRIVFVIPWMDEFSIIGTTDVEYNGDPHDVKIDDNEVNYLLKVYNDHF
KKQLSKDDIVWTYSGVRPLCDDESDSPQAITRDYTLDVHDQDGKAPLLSVFGGKLTTYRK
LAEHALEKLSGYYDNCGPAWTKNGVLPGGDLGTDRDSYAAQLRRRFTWLPEALARRYVRT
YGTRAEQLIGTAQSLEDLGEHFGHHLYEAELRYLVAEEWVVELDDAIWRRTKLGMWLDDA
QKQRVAQWLAEHKS
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaccaaagacttgatcgttatcggtggtggcattaacggtgccggtatcgctgcg
gatgcggcaggacgcgggctttccgttctgatgctggaggctaaagatttggcctgcgcc
acgtcatctgcgagctccaaattaatccacggtggcctgcgctatctggaacactatgag
tttcgtttggtgagcgaagccttggcagagcgtgaagttctgctgaaacttgcgccgcat
atcgccttcccgatgcgtttccgcttaccacatcagccacatttgcgcccagcttggatg
atccgtactggcctattcctttacgatcatttgggtaaacgcaccagcttgccaagcagc
aaaggcctacgctttggtcctgaatcagtcttgaaatccagcttaacgcgtgggtttgag
tattcagattgctgggttgatgatgctcgtctggtgctgttaaacgcgcaagaagttgtg
gtgcgcggtggtgaagttcgcactcgtactcaggtcactcgcgcctatcgtgaaaatgga
ttgtgggtggtagaagccaaaaacgcagacacgggtgaagtctttacctggcgtgccaaa
ggtctggtgaatgccaccggcccatgggttaaacatttcttcgataacggattagagctg
aaatccccttatggtatccgtctgatcaaaggtagccatattgtggttccgcgtgttcat
aatcagccgcaggcttatatcctgcaaaacgaagatcatcgtattgtctttgtgatcccg
tggatggatgagttttctatcatcgggactaccgacgtggaatataacggcgatccgcat
gatgtgaagattgatgataatgaagtgaattacctgctgaaggtttataacgatcacttc
aagaaacagttgagcaaagacgacatcgtctggacttattccggtgtgcgcccgctgtgt
gatgacgaatcagattctccacaggcgatcacccgtgactatacgctcgacgtgcacgat
caggatggtaaagcgccgctgctttccgtatttggcggtaagctcaccacctatcgtaaa
ctggctgaacatgcgctagaaaaactgtctggttattacgataactgtggtcctgcatgg
actaaaaatggtgtattgccggggggcgatttaggcaccgatcgtgatagctatgctgcg
cagctgcgtcgccgctttacgtggttgccagaagcgttagcccgccgctacgtgcgcact
tacggcactcgcgctgaacagctgatcggaactgcgcaatcactggaagatctgggcgag
cactttggccatcatctgtatgaagctgagctgcgttatctggttgccgaagagtgggtg
gttgagcttgatgatgcgatctggcgccgaactaagttaggtatgtggctggatgatgcg
cagaaacagcgcgtcgcgcagtggctggcagagcataagtcataa

DBGET integrated database retrieval system