KEGG   Helicoverpa armigera (cotton bollworm): 110371782
Entry
110371782         CDS       T05609                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member wengen
  KO
K16679  wengen
Organism
haw  Helicoverpa armigera (cotton bollworm)
Pathway
haw04013  MAPK signaling pathway - fly
haw04214  Apoptosis - fly
haw04215  Apoptosis - multiple species
haw04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:haw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    110371782
   04391 Hippo signaling pathway - fly
    110371782
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    110371782
   04215 Apoptosis - multiple species
    110371782
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 110371782
NCBI-ProteinID: XP_021183843
LinkDB
Position
Unknown
AA seq 232 aa
MSRKEVMLGDIPKLCLLVATLALGSVAGSGACERGLSWWDRQRGTCVPCTRCDPAKRLVV
RYPCEIHRDTICQSLYEAQISPFNTPKQVLKKNNEISELLSSDDEYEYVDYDSEVTSRND
VSWDLQTTSLSVAASGCIVFFVVVLVMSLYHARQWRVIKRFVKVFINFTDVQDLTAKLKL
MEAGGETTAEPVVAADHHIYCNIHNLGKEALLGPNSTKKGLGNVYTQEKHNS
NT seq 699 nt   +upstreamnt  +downstreamnt
atgagtaggaaggaggtaatgctaggtgatatacccaagttgtgtttgctggtagctaca
ctggcacttgggtctgtggcggggagcggcgcctgcgagcgcgggctgagctggtgggac
cggcagcgcggcacctgtgtgccctgcacccgatgcgaccccgccaagagactagtcgtc
agatacccctgcgaaatccacagggacactatctgccagtcgttgtacgaagcccaaatc
tctcctttcaatacaccgaaacaggtgcttaaaaaaaacaatgaaatcagtgaactgcta
tccagtgatgacgagtacgaatatgtggactacgatagtgaagtgacgtctagaaacgat
gtgtcgtgggatctgcagacgaccagcctcagcgtggccgcgagtggctgtatcgtgttc
ttcgtcgtggtgctggtgatgtcgctgtaccatgccaggcagtggagggtcatcaagcga
tttgtaaaagtgtttattaattttacagatgtacaagatttgacggcgaaattaaaatta
atggaagctggaggcgaaacgacagcagagccggtcgtggcagctgaccaccacatctac
tgcaacattcacaacttaggcaaggaggcgttacttggtccgaattcaactaaaaaagga
ttgggcaatgtgtacacacaggagaagcacaactcttag

DBGET integrated database retrieval system