KEGG   Helicoverpa armigera (cotton bollworm): 110371932
Entry
110371932         CDS       T05609                                 

Definition
(RefSeq) bcl-2-related ovarian killer protein homolog A-like
  KO
K20017  Bcl-2 family protein
Organism
haw  Helicoverpa armigera (cotton bollworm)
Pathway
haw04214  Apoptosis - fly
haw04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:haw00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    110371932
   04215 Apoptosis - multiple species
    110371932
SSDB
Motif
Pfam: Bcl-2 DUF3325
Other DBs
NCBI-GeneID: 110371932
NCBI-ProteinID: XP_021184070
LinkDB
Position
Unknown
AA seq 291 aa
MRRKLSTPLSAMPGVTDGLISLPNLRASPTRALSPLDRTKRRFSTMVSSAAAAAVSRRLS
ATIGWCLASPTQVKPQIVRQGRALCLQYIKTQIRRSTLCAKKQIVMKRLQRMVETECGEE
AVSNSESGVLAGLRALCAALERKRPDAFRHVARQATRAPSAMLRSDTALAELALALARRI
TRENITWSKIAAVYCVCGALAREAAEAADGEPALELVSAPAAAIADLLHEDPGSWIASHG
GWNGLVERLRASERDQRSEKNLRVMVSFFVFVCLTLLLFRWVLHAHPAYNE
NT seq 876 nt   +upstreamnt  +downstreamnt
atgcgtcgcaagctcagcacgccgctcagcgcgatgcccggagtaactgatggactgatt
agcttaccaaatctacgagcttcgccaacgcgggcactgtcgccgttggaccggacgaag
cgtcgcttcagcacaatggtgtctagtgcggccgccgcagcagtgtccaggcggctctcg
gcaactatcggctggtgtctcgccagccccacgcaggttaagccgcaaatagtccgccaa
ggacgcgccctatgcttgcaatacattaagactcagattaggagatcaactttatgtgcg
aaaaagcaaatagtaatgaaacgtttacaacgaatggtggagacggagtgtggggaggag
gctgtgagcaactcagagtcgggggtactggcggggctccgggcgttgtgcgccgcactg
gagaggaagcggccggacgccttccgtcacgtcgcgcggcaggccacgcgcgccccttcc
gccatgctccgctcagacacagcactcgcggagctagcactagctctagcgagacgcatc
actagagagaatattacctggtccaagatagcagctgtatattgtgtttgtggagccctg
gcgagagaagcggcagaagctgctgatggggaaccagctctggagttggtgtcagcaccc
gccgcggccatcgccgacctgttgcatgaagatcctggctcctggattgcgtcacatggt
ggatggaatggcttagtggagcgacttcgagccagcgaaagagaccagcgatctgaaaag
aatcttcgagtgatggtgtccttctttgtgttcgtgtgtctgaccttactgctgtttcga
tgggtccttcacgcacatcccgcgtacaacgagtag

DBGET integrated database retrieval system