KEGG   Helicoverpa armigera (cotton bollworm): 110374859Help
Entry
110374859         CDS       T05609                                 

Definition
(RefSeq) carbonyl reductase [NADPH] 1-like
  KO
K00079  carbonyl reductase 1 [EC:1.1.1.184 1.1.1.189 1.1.1.197]
Organism
haw  Helicoverpa armigera (cotton bollworm)
Pathway
haw00590  Arachidonic acid metabolism
haw00790  Folate biosynthesis
haw00980  Metabolism of xenobiotics by cytochrome P450
haw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:haw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    110374859
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    110374859
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    110374859
Enzymes [BR:haw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.184  carbonyl reductase (NADPH)
     110374859
    1.1.1.189  prostaglandin-E2 9-reductase
     110374859
    1.1.1.197  15-hydroxyprostaglandin dehydrogenase (NADP+)
     110374859
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR
Motif
Other DBs
NCBI-GeneID: 110374859
NCBI-ProteinID: XP_021188433
LinkDB All DBs
Position
Unknown
AA seq 276 aa AA seqDB search
MYDVALVVGAASNLGYQVLKKLTENYHGKIYFTAEDETTGFNILKNLERENLDLNFLQMD
VTYTKSIIKVRHYIQDLDERIDLIINVTDYVPEKKISHSEIVRRTLSVNFYGYINFGKLV
YPILNENARVVNVSGPAGLLATIENDEIRQRISDPKLTEDELVAILQDYEQAARRGTEKT
EGWGMSVHSVSKVALNAVTFLQHREWADRGIVINCVNPGNLNSREGRKTAKMYEEGAKAI
LYLAFEAPLSLKGNFVWSNYSVIEWNSDPYVEVTTV
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgtacgacgtcgctctagtcgtcggcgccgccagtaacctcggctaccaagtactcaag
aaactaacagaaaactaccatggaaaaatttacttcaccgcagaagatgaaaccacagga
ttcaacatactcaaaaacctggaaagagaaaacttagatctgaacttcttacaaatggat
gtcacttacacgaagagtattatcaaggtcagacattacatccaggatttagacgagaga
atagacctgatcatcaacgtgacggactacgtgccagaaaagaagatatctcactcggaa
attgttagaagaacgctcagtgtcaacttctatggatacatcaactttgggaaattagtg
tacccgatattaaatgagaacgccagagttgtgaatgtttctgggccggctggcttgctg
gcaactatagaaaacgatgaaatcagacagaggataagtgatcctaaactgacagaagat
gaactagttgctattttgcaagattacgaacaggcggctagaagagggaccgagaagact
gaaggatggggtatgagtgtccattctgtgagtaaggtcgctttgaatgccgtcacattc
ttacaacacagagagtgggcagacagaggaatagtgatcaactgtgttaaccctgggaat
ttgaacagcagagaaggaaggaaaacggcgaagatgtatgaggaaggagctaaagcgatc
ctgtacttggcttttgaagcacctctgtcgctgaagggtaatttcgtgtggagcaactat
tctgtgatcgaatggaactctgacccgtatgtagaagtgacgaccgtgtga

DBGET integrated database retrieval system