KEGG   Helicoverpa armigera (cotton bollworm): 110376134Help
Entry
110376134         CDS       T05609                                 

Definition
(RefSeq) trypsin CFT-1-like
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
haw  Helicoverpa armigera (cotton bollworm)
Pathway
haw04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:haw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110376134
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:haw01002]
    110376134
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:haw04147]
    110376134
Enzymes [BR:haw01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     110376134
Peptidases [BR:haw01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   110376134
Exosome [BR:haw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110376134
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 MBOAT_2
Motif
Other DBs
NCBI-GeneID: 110376134
NCBI-ProteinID: XP_021190189
LinkDB All DBs
Position
Unknown
AA seq 263 aa AA seqDB search
MRAVILLALLGSALAVPKSVNRIVGGSATTVEAYPYMSNMQYGFWGIWWYQACGGSLLTS
TSILSAAHCYFGDSPLEWNVRLGTSLASSGGTLHTVSQLVLHPQYSSATLDHDVAIVRLT
VPATFSNTIQPASIPGSSYSLPDNTLLTTVGWGALSSGGGFPQQLQHVDINLINQELCAE
RYAFLKTQPGYQNWPDITDNMLCAGILDVGGKDACQGDSGGPLAHNSNIIVGVVSWGFQC
ADPFYPGVNARVSRYTDWIIANA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccgtcatcctgttagcccttttgggctccgcactcgcggtccccaaatccgtc
aaccgcattgtgggcggcagcgccaccactgtggaggcctacccctacatgtccaacatg
cagtatggtttctggggcatctggtggtaccaggcctgcggtggatctctgttaacctcc
acctccatcctctcagctgctcactgttacttcggtgactcacctctggagtggaatgtg
cgcctgggcacgtccctggcctccagcggcggcacccttcacaccgtgtcccagttggtg
ctgcacccgcagtacagcagcgctaccctggaccacgacgtcgccatcgtccgcctcacc
gtccccgccaccttctccaacactatccagcccgccagcatccccggcagcagctactct
cttcccgacaacacccttctgaccactgttggatggggagcactctcgagcggcggtgga
ttccctcagcagctgcagcacgttgacatcaacctcatcaaccaggagctctgtgctgag
cgttacgccttcttgaagacccagcctggttaccagaactggcccgacattaccgacaac
atgttgtgcgctggtatcttggatgtcggcggcaaggacgcttgccagggagactccggc
ggtcccctcgctcacaacagcaacatcatcgttggtgttgtgtcctggggcttccagtgc
gctgatcccttctaccctggtgtcaacgcccgcgtgtctcgctacactgactggatcatt
gctaacgcttaa

DBGET integrated database retrieval system