KEGG   Helicoverpa armigera (cotton bollworm): 110376916Help
Entry
110376916         CDS       T05609                                 

Definition
(RefSeq) sorbitol dehydrogenase-like
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
haw  Helicoverpa armigera (cotton bollworm)
Pathway
haw00040  Pentose and glucuronate interconversions
haw00051  Fructose and mannose metabolism
haw01100  Metabolic pathways
Module
haw_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:haw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    110376916
   00051 Fructose and mannose metabolism
    110376916
Enzymes [BR:haw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     110376916
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C
Motif
Other DBs
NCBI-GeneID: 110376916
NCBI-ProteinID: XP_021191243
LinkDB All DBs
Position
Unknown
AA seq 358 aa AA seqDB search
MATDNLTAVLNKPKDLQLVQTPIPEIADDEVLLRMDCVGICGSDVHYWQSGACGHFVLKE
PMIMGHEASGVVAKLGAKVKNLKVGDRVAIEPGVPCRYCEFCKTGRYHLCPDMLFCATPP
VHGNLVRYYKHAADFCYKLPDHVTMEEGALLEPLSVGIHACRRANLTGGHIVLVLGAGPI
GLLTMLSAKAMGASKVLITDIFQSRLDFAKQLGADHTLLVTRDSNEPELVKKIHELLGEH
PDVSFDASGAQASVRMALLATKSGGVAVLVGMGAPEQTVPLAGTLAREVDIRGVFRYVNE
YPIALNMVASGKINVKPLVTHHFSMEQTLEAYEVARQGSGIKVMIHVQPRDANNPKKF
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggccacggacaatctaaccgcagttctcaataaacccaaggatttacaactggtgcaa
acaccgataccagaaattgctgacgatgaggtgctactccgcatggactgcgtcggcatc
tgtgggtctgatgtccactactggcagagtggcgcttgtggacacttcgtactcaaagag
cccatgattatggggcatgaggcttcgggagtcgtcgctaagctcggtgccaaagtgaag
aacctgaaggtgggagaccgcgtggccatcgagcccggcgtgccgtgccgctactgcgag
ttctgcaagacaggccgctaccatctgtgtcctgatatgctgttctgtgccactcctccc
gtgcatggaaaccttgtcagatattacaaacatgctgctgacttctgttacaaactccca
gaccacgtgaccatggaagagggtgccctcctggagcctctatcggtcggcatccatgcg
tgccggcgcgcaaacctcacgggcggacacatcgtgctggtgctgggtgccggacctatt
ggcctgctcactatgctgtcggctaaggctatgggtgccagcaaagtgctgattacagat
atattccagtctcggttagacttcgcaaagcagctgggagcagaccacacactcctggtg
acgcgcgactccaacgagccggaactcgtcaagaagatccacgagctgctgggagaacac
cctgacgtgtcgttcgacgctagtggcgctcaggcttctgtcagaatggccttattggcg
acgaagtcaggcggcgtggcagtgctagtcggcatgggtgcgccggagcagacggtgccg
ctcgccggcacgctcgccagggaggtcgacatccgcggcgtcttccgatatgttaacgaa
taccccatcgcgctaaacatggttgcgagcggcaagatcaacgtgaagccgctggtgacg
caccacttcagcatggagcagaccctcgaggcctacgaggtggcgcggcagggctccggc
atcaaggtcatgatacacgtgcagcccagagacgctaacaaccccaagaagttctag

DBGET integrated database retrieval system