KEGG   Helicoverpa armigera (cotton bollworm): 110376990Help
Entry
110376990         CDS       T05609                                 

Definition
(RefSeq) carbonyl reductase [NADPH] 1-like
  KO
K00079  carbonyl reductase 1 [EC:1.1.1.184 1.1.1.189 1.1.1.197]
Organism
haw  Helicoverpa armigera (cotton bollworm)
Pathway
haw00590  Arachidonic acid metabolism
haw00790  Folate biosynthesis
haw00980  Metabolism of xenobiotics by cytochrome P450
haw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:haw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    110376990
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    110376990
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    110376990
Enzymes [BR:haw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.184  carbonyl reductase (NADPH)
     110376990
    1.1.1.189  prostaglandin-E2 9-reductase
     110376990
    1.1.1.197  15-hydroxyprostaglandin dehydrogenase (NADP+)
     110376990
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase HATPase_c
Motif
Other DBs
NCBI-GeneID: 110376990
NCBI-ProteinID: XP_021191336
LinkDB All DBs
Position
Unknown
AA seq 287 aa AA seqDB search
MERVAVVTGSNKGIGFAIVKGLLQRFQGVVYLTSRDEGRGKDAVAKLNQLGLYPQYHQLD
VTDRLSITKFRDHIKQKHGGIDILVNNAAVANSTALYNSYEECKTIVDINYFSILTIQEL
LFPLVRDNGRILNISSDCGHLSNVRNKYWIERLSKKDLTLEDINEFVNWFLDGVKNNTFN
YDDIADDGKIAAYRVAKVALSANTRLQQKALEGRNISVNSMHPGLVQTDMTRGVGFYSAD
QAAETPLYLVLEAPATLKGEYIWYDRRVLDWYDHKADYYFKTINLKQ
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggagcgagtcgctgttgtcaccgggtccaacaagggcatcggcttcgctatcgtcaag
ggtctcctgcagagattccaaggagtcgtgtacctgacgtcaagagatgaaggcagaggc
aaggatgccgtcgccaagctgaaccagctcggactctacccacagtatcaccagcttgac
gtgaccgatagactcagcatcaccaagttcagagaccacatcaaacagaaacatggagga
attgatatcctagtgaacaacgcggcagtggcgaacagcacagcgttatacaactcctac
gaagaatgcaaaaccattgtagacattaactacttcagcatcctgaccatccaagagctg
ctgttcccactggtgagagacaacggacgtatcctgaacatctcgagcgactgcggacac
ttatctaacgtacgtaacaagtactggatagagagactgtcgaagaaagacttgacatta
gaagatattaatgagttcgtcaactggttcttggacggagttaagaataatacgtttaat
tacgacgatatagctgatgatggcaagattgctgcgtacagagtggcgaaggttgctctc
agcgcgaacacgaggctgcagcagaaggcgttggaaggcaggaacatctccgtgaactcc
atgcaccctggcctggtgcagactgacatgacgcgaggagttggcttctacagcgcagac
caggcagccgaaactcctctgtacctggtgctagaagctccagctacgctcaaaggagaa
tacatttggtacgacagaagagttctagactggtatgaccacaaagctgattactatttt
aaaacaataaatttaaaacagtag

DBGET integrated database retrieval system