KEGG   Helicoverpa armigera (cotton bollworm): 110379984Help
Entry
110379984         CDS       T05609                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial-like
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
haw  Helicoverpa armigera (cotton bollworm)
Pathway
haw00020  Citrate cycle (TCA cycle)
haw00190  Oxidative phosphorylation
haw01100  Metabolic pathways
haw01200  Carbon metabolism
Module
haw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
haw_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
haw_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:haw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    110379984
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    110379984
Enzymes [BR:haw01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     110379984
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA HI0933_like
Motif
Other DBs
NCBI-GeneID: 110379984
NCBI-ProteinID: XP_021195506
LinkDB All DBs
Position
Unknown
AA seq 640 aa AA seqDB search
MITFFVKKQAGWLTRRLRAQLVSKNSIRRASFTVHHHCHDCVVIGAGGAGLRAAIGFAEA
KFSVAMVSKLFPTRSHTIAAQGGMNAALGSMHADDWKYHFYDTVKGSDWLGDQDSIHYLT
REAPVCVLELENMGMPFSRTKEGKIYQRPFGGGTVNFGKSVAKRTCAVADRTGHALLHTL
YGYYTKFKNIDTFTEFFVLDLLVQDGEVVGCLAIDMDDGSIHRFQAKHTVMSTGGYPRMY
FSCTAAHTCTGDGTAMASRAGIPLQDMEFIQFHPTGMYGSGCLMTEGARGEGGYLVNSEG
KRFMEKYAPKAKDLASRDVVSRSMATEIRQGRGVGPKKDHVHLQLHHLPAETLREKLPGI
SESAFTFTGADVFTQPVPVIPTVHYTMGGIPINYKGEALVHQNGKDCIVPGLYAAGEVVS
NAHGANRLGANSILDVVVFGKSISLTVAKNFKPGEKQVALKDNICEATLDNLEKVKNACG
CAAPHELREAMRHSMQGKCGVFRDAKLLNEADLEIQKWYRAFEDIKVTDKRANWNTDLIE
ALELQNMLQCAVQVVACAKNRTESRGAHFRDDCPKRLDEFDYSRSTEGQKKKSFTEHWRK
HSMSTLDLCSGKVTISYRPVIDKTLDDREVKWIPPVPRVY
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgataactttttttgtaaagaagcaggccggctggctgacaaggcgtttgcgtgcccag
ttagtatcgaagaatagcatccgtcgtgcctcgtttactgtccaccatcactgccatgac
tgcgtggtcatcggcgctggtggggccgggctcagggctgccatcggctttgctgaagct
aaattctcagtagctatggtttccaagctgttccccactcgttctcacacaattgctgct
caaggcggcatgaatgctgctcttgggagcatgcacgcggacgattggaaatatcatttc
tatgatactgtcaaaggatcggattggctcggtgatcaggattccatacactacctaact
cgtgaggctcctgtctgtgtactagaactggagaacatgggcatgccgttttcaaggaca
aaagaagggaaaatataccagagacccttcggtggaggaaccgtgaattttggcaagtct
gtagccaaaaggacgtgtgctgttgctgaccgcaccggtcacgccctacttcacacgttg
tatggatactatacaaagtttaagaacatcgatactttcacagagttctttgtgctagat
ttgttggtgcaggatggggaagttgttgggtgtctggctatagacatggatgacggaagc
attcacagattccaagccaagcacacagtaatgtcaactggaggctacccgaggatgtac
ttctcgtgcacagccgcgcacacttgtactggtgacggaaccgctatggcctcgcgggct
ggcattccgctgcaggatatggagttcattcagttccaccccactggtatgtatggctca
ggctgcctaatgacggaaggtgctcgtggtgaaggtggatatctggtgaacagcgaaggc
aagcgctttatggagaagtatgctcccaaagccaaggacttggctagccgtgacgtcgtg
tctagatcaatggccactgaaatacgacaaggtcgaggagttggaccgaaaaaagaccac
gtgcacttacaattgcaccatctccccgctgagacgttgagagagaagcttccagggatc
tcggagtcggcctttaccttcacgggtgctgacgtgttcacccaacctgtaccagtcata
cccaccgtccattacaccatgggcggtatacccatcaactacaagggagaggcgctagtc
caccagaatggcaaggattgtattgtacctggactgtacgcagctggtgaggtagtcagc
aatgcgcacggtgccaacaggcttggggccaattctatcctcgatgttgtagtcttcggg
aaatcaatatctttaactgtagcaaagaactttaagccaggagaaaaacaagttgcttta
aaagacaatatctgcgaagcgacacttgataatttagaaaaggtcaaaaatgcgtgtggc
tgtgctgctccacatgaactaagggaagcaatgagacacagtatgcagggtaaatgtgga
gtattcagagatgccaagctgcttaacgaagctgacctggaaattcagaaatggtacaga
gctttcgaagacattaaggtgacagacaagcgagctaactggaatactgatctgatcgaa
gctctggagttgcaaaacatgctccaatgtgctgttcaggtagttgcctgcgctaaaaat
agaactgagagcagaggtgctcacttcagggatgattgcccgaagagacttgacgaattc
gactacagcagatccactgagggacagaaaaagaagtcctttacagaacactggaggaaa
cactctatgtccacgttggacctttgctctggcaaagtaacaatttcatacagaccggtg
attgacaaaacgttggacgatagagaagtgaaatggatccctcccgtacccagggtctac
taa

DBGET integrated database retrieval system