KEGG   Halobacteriovorax sp. BALOs_7: BALOs_0552Help
Entry
BALOs_0552        CDS       T05649                                 

Definition
(GenBank) leucine--tRNA ligase
  KO
K01869  leucyl-tRNA synthetase [EC:6.1.1.4]
Organism
hax  Halobacteriovorax sp. BALOs_7
Pathway
hax00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:hax00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BALOs_0552
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hax01007]
    BALOs_0552
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hax03016]
    BALOs_0552
   03029 Mitochondrial biogenesis [BR:hax03029]
    BALOs_0552
Enzymes [BR:hax01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.4  leucine---tRNA ligase
     BALOs_0552
Amino acid related enzymes [BR:hax01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BALOs_0552
Transfer RNA biogenesis [BR:hax03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BALOs_0552
 Prokaryotic type
    BALOs_0552
Mitochondrial biogenesis [BR:hax03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BALOs_0552
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1 tRNA-synt_1_2 tRNA-synt_1g Anticodon_1 tRNA-synt_1e tRNA-synt_1f DUF4265
Motif
Other DBs
NCBI-ProteinID: AYF43564
LinkDB All DBs
Position
complement(568290..570698)
Genome map
AA seq 802 aa AA seqDB search
MQYNFGEIEPKWQKFWEDNKTFRTDSTDKTKPKYYVLDMFPYPSGAGLHVGHVEGYTATD
ILARFKRMNGHNVLHPMGWDSFGLPAENYAIKTGTHPNVITKENIGNFTRQLKACGFSYD
WDREIATSSIDYYKWTQWIFTQLYNKGLAFEDEISVNWCPELKTVLANEEVIDGKSEVGG
HPVVRKPMKQWMLKITEYADRLLEDLDDLDWPESLKELQRNWIGRSEGAQVSFEVKGADS
KIDVFTTRPDTLFGATYMVLAPEHDLVAKITTEDQKADIEAYIKEAALKSDLDRTDLNKN
KSGVFTGAYAINPLNGKEIPIWIADYVLISYGTGAIMAVPAHDERDWEFAKKYDLEILPV
LEGGDVNEAAFTGDGTHINSDFLDGLNKEDAISKVIAHLEEKNIGKKEINYKLRDWLFSR
QRYWGEPFPILKFEDGTVRCLDEDELPVGLPEVEKYEPSGTGESPLARIDDWLYLTDPKT
GKKARRETNTMPQWAGSCWYYLRFIDPKNSEVAWDKQLEEYWMPVDLYVGGVEHAVLHLL
YARFWHKVLFDLGLVSTKEPFQKLFNQGLILDEHGEKMSKSKGNTVNPDDIIKEYGADAL
RLYEMFMGPLEKVKPWQTKGVKGVFNFLRKSFTFYGNPENTYEGEEKNQDVLKHLHKTIK
KVTEDVENLRFNTAISAMMVMNNEVIKLGQVSVETAKAFTRLLSPFAPHAAEEMWANLGE
TTSCSLAPWPTFDPELAKDDLITMAIQVNGKTRSTIDVPADISKEDFLAQAKADEKVAKF
ITGTIVKEIYVPGRICNIVVKG
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atgcagtacaactttggtgagattgaaccaaaatggcaaaagttttgggaagacaacaaa
acttttagaaccgactcaacagacaaaacgaaacctaaatactatgtattggatatgttt
ccttatccatcaggtgcaggacttcacgttggtcacgttgaaggatacacagcaacagat
atcttagctcgttttaaaagaatgaatgggcacaatgttcttcacccaatgggttgggat
tcatttggacttcctgctgagaactacgccatcaaaacgggaactcacccaaatgtaata
acaaaagaaaatattggaaacttcacaagacaactaaaggcttgtggattctcatatgat
tgggatcgtgagatcgcaacttcaagtattgattactataagtggactcaatggatcttt
actcaactttataataaaggcctagcttttgaagatgagatttctgttaactggtgtcct
gaacttaagacagttctagctaacgaagaagtaatcgatggaaaatctgaagttggtggc
cacccagttgttagaaaaccaatgaagcagtggatgttaaagattactgaatacgcagac
cgtcttctcgaagatcttgatgatcttgattggccagagtctctaaaagagttacaaaga
aattggattggtcgctctgaaggtgcacaggtttcttttgaagtaaaaggtgcagattcg
aaaattgatgttttcacaactcgtccagatactctttttggtgcaacgtacatggtccta
gctcctgaacacgacctagttgcaaaaattaccactgaagatcaaaaagcagatattgaa
gcctatatcaaagaagcggcccttaagtctgatcttgatcgaacggatctaaataagaat
aagtccggtgttttcactggcgcttatgcaatcaaccctcttaatggaaaagagattcca
atttggattgctgattatgtcctaatctcgtacggaacaggagcgatcatggccgttcca
gctcatgacgaaagagactgggaatttgctaagaaatacgaccttgaaatccttccagtc
cttgaaggtggagacgttaatgaagcggccttcactggagatggtacccatattaattca
gacttcctagatgggctaaataaagaagatgcgatttcaaaagttatcgctcaccttgaa
gaaaaaaatatcggaaagaaagaaattaactacaagcttcgcgactggttattttctcgt
caaagatactggggagaaccattcccaattttaaaatttgaagatggaactgtaagatgt
cttgatgaagatgagcttccagttggtcttcctgaagttgaaaagtatgaaccatcggga
actggtgagtcaccactagctcgcattgatgattggttatacttaactgatccaaagaca
ggcaagaaagcaagacgtgaaacaaatacaatgcctcagtgggcagggtcttgttggtac
tacctacgcttcattgatccaaagaactctgaagttgcatgggataagcaattagaagaa
tactggatgccagtcgatctgtatgttggtggagttgagcacgctgttcttcacctactc
tacgctcgcttctggcacaaggttctatttgatcttggacttgtttccacaaaagagcca
ttccagaaacttttcaaccaaggtcttatcctagatgagcatggtgagaagatgagtaag
tcaaaaggaaatactgtaaacccagatgatatcatcaaagaatacggtgcagatgctctt
agactttatgaaatgttcatggggccacttgaaaaagttaagccgtggcaaacaaaaggt
gtaaaaggagtatttaacttccttagaaaatcattcactttctatggaaacccagaaaat
acttacgaaggtgaagagaagaatcaagatgttctaaagcacctacacaagacaattaaa
aaagttactgaagatgtagaaaaccttcgctttaacacagcgatctcagcaatgatggta
atgaataacgaagttattaaacttggtcaggtttcagttgagacggccaaagcatttaca
agacttctttctccatttgctccacacgctgctgaagagatgtgggcaaatttaggtgaa
acaacttcttgttcacttgctccgtggccgacctttgatcctgagcttgctaaagatgac
ctaatcacaatggccatccaagtaaatggtaaaacgagatctacaattgatgtacctgct
gatatctcaaaagaagactttcttgcacaggccaaggccgatgagaaagtagcaaagttt
atcacgggaacaattgttaaagagatctacgttccgggaagaatttgtaacattgtagtt
aaaggataa

DBGET integrated database retrieval system