KEGG   Halobacteriovorax sp. BALOs_7: BALOs_0912Help
Entry
BALOs_0912        CDS       T05649                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
hax  Halobacteriovorax sp. BALOs_7
Brite
KEGG Orthology (KO) [BR:hax00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BALOs_0912 (ahpF)
Enzymes [BR:hax01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BALOs_0912 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA HI0933_like FAD_oxidored Thi4 DAO Thioredoxin_3 FAD_binding_2 FAD_binding_3 NAD_binding_8 AlaDh_PNT_C Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AYF43922
LinkDB All DBs
Position
910002..911552
Genome map
AA seq 516 aa AA seqDB search
MLDNAIIEQLKSVYANLESEIGLVYSESSNSKQQELVEMLESIAGTSPKISTKSSGETYD
YPHFEIQVNGKANGIKFSGIPGGHEFTSLILAILNSDLKGKLPDDMIINRIKALKGSIDL
KTYISLSCENCPDIVQALNLMAIYKEDFTHEMIDGEFVQDEIKELKIQGVPSVIHDKDLV
HSGKSSLVDLLEKLEERFGKDESSTSNETKDLGEYDVIVIGGGPAGASSAVYTARKGLKT
AIITDRVGGQMQDTKGIENFISVPYTEGPELSAALGKHVSEYDIKLLEHRRVDNIENGEL
KTLFLNSGEVVKTKSLIIATGAKWRELGVEGEKDYLGRGVAYCPHCDGPYYKGKDVSVIG
GGNSGVEAAIDLAGIVKSVTVVEFAPELKADQVLIDKLESLKNVTIIKNARTDKVIGDGE
KVVALEYEDRDSGDIKKIDLDGVFVQIGLVPNTAFLGDLVEKNKFGEIIVTDKCRTNQER
IYAAGDVTTVPYKQIIISMGEGAKAGLTAFEDLMLS
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgttagataacgcaatcattgaacaattaaaatcagtctatgctaatttagaaagtgag
attggacttgtgtacagtgaatctagcaattcaaagcaacaagagcttgtagagatgcta
gagagcatcgcaggtacttctcctaaaataagtacaaagtcgagtggggagacttatgat
tacccacattttgaaattcaagttaatgggaaggcaaatggaattaaattttcagggatc
cctggaggacatgagtttacctctttaatcctggccattttaaatagtgatctaaaaggg
aagctccctgatgatatgatcattaaccgaataaaagctcttaaaggatcaatagatctt
aagacatatatttctctttcatgtgaaaactgtcctgatattgttcaggccttaaactta
atggccatttataaggaagattttactcatgaaatgattgatggtgaattcgtccaagat
gaaattaaggaattgaaaattcaaggtgtaccaagtgttattcacgataaagaccttgta
cattctggtaagtcatcacttgttgatctccttgagaagttagaagagcgctttggcaaa
gatgagagctcaacttcaaatgaaactaaggaccttggagagtacgatgtcattgttatt
ggtggtggtcctgctggtgcgtcttctgctgtttatacagcaagaaaaggcctaaagact
gccattatcactgatcgtgttggtggtcagatgcaagatactaagggaatcgaaaatttt
atttctgttccatatactgaaggccctgagctttcagctgcacttggaaaacatgtttca
gaatacgatattaagctattagaacatcgtcgtgttgataatattgaaaatggagaactt
aagactttatttttaaatagtggtgaagtggttaaaacaaagtctcttattattgcaacg
ggtgctaagtggcgcgagctaggagttgaaggagaaaaagactatctaggacgtggtgtt
gcttattgtcctcactgtgatggaccttattataaaggcaaggatgtaagtgtaatcggt
ggtggaaactctggagttgaagcagcgatcgatcttgctggaattgttaagtctgtaacg
gttgtggagtttgctcctgagttaaaggccgaccaagttttaattgataagttagagtca
ctaaagaatgtaacaattattaaaaatgctcgaacagataaagtcattggagacggtgaa
aaggttgtggcccttgaatatgaggaccgtgattctggagatattaaaaagattgatctc
gatggagtctttgtccaaattgggctcgttccaaataccgctttcttaggtgatcttgtg
gaaaaaaataaatttggtgaaattattgtgactgataaatgtcgcacgaatcaagaaaga
atttatgcggcaggtgatgttacaactgttccgtataagcaaattattatttcaatgggt
gagggggccaaggccggacttactgcatttgaagacttaatgctgtcataa

DBGET integrated database retrieval system