KEGG   Halobacteriovorax sp. BALOs_7: BALOs_1356Help
Entry
BALOs_1356        CDS       T05649                                 

Gene name
fabI
Definition
(GenBank) oxidoreductase, short chain dehydrogenase/reductase family protein
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
hax  Halobacteriovorax sp. BALOs_7
Pathway
hax00061  Fatty acid biosynthesis
hax00780  Biotin metabolism
hax01100  Metabolic pathways
hax01130  Biosynthesis of antibiotics
hax01212  Fatty acid metabolism
Module
hax_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:hax00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BALOs_1356 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BALOs_1356 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    BALOs_1356 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hax01004]
    BALOs_1356 (fabI)
Enzymes [BR:hax01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     BALOs_1356 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     BALOs_1356 (fabI)
Lipid biosynthesis proteins [BR:hax01004]
 Fatty acid synthase
  Component type
   BALOs_1356 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short TMEM126 KR
Motif
Other DBs
NCBI-ProteinID: AYF44359
LinkDB All DBs
Position
1382187..1382969
Genome map
AA seq 260 aa AA seqDB search
MSFLNFENKLFLITGVANKKSVAYFSAKTIIENGGNCVFTVQSEEHQAKLKKLFPDSKSY
IVDVTKEEQIKELAINLKNDEVKLDGMLHSIAFANLANPRPFHETSWEDFAQATQISSFS
LVQLSNELAALFEHEASVVTISISDTKATSYGYMGPIKSMLETTCSYLAKSFSEFSQVRF
NSVCSGPLKTSASAGIPGYIDNYIFAEKLTMRKQALKTQEVANTVAFLLSNASSGINATG
VLVDCGMKSNHFDQEVVSGK
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgagttttttaaattttgaaaataaattatttctaataactggtgttgctaataagaag
tctgttgcatactttagtgcaaagacaatcattgaaaatggtggaaattgtgtctttact
gttcaaagtgaagagcatcaagcaaagctgaagaagctctttccagattctaaaagctat
atcgttgatgtgacaaaagaagagcaaattaaagaattagcaattaatctaaaaaatgat
gaagttaaactcgatggtatgcttcattcaattgcctttgcaaatcttgcaaaccctagg
ccttttcatgaaacatcttgggaagactttgcgcaggcgacacagatctcttcattttca
cttgtacaattatcaaatgaattggcagcgctatttgaacacgaagcttctgttgtaacg
atttcaatctcggatacgaaggccacttcatatggttatatggggccaattaagtcgatg
cttgagacaacgtgctcatatcttgcaaagagctttagtgagttttcacaagttcgcttt
aatagtgtttgctcagggcctttaaaaacatcggcttcagcgggaatccctggctatatt
gataattatatctttgctgaaaagcttaccatgagaaagcaggccttaaaaactcaagaa
gttgccaatacagttgccttcttactttcaaatgcttcaagcggtatcaatgccactggt
gttcttgttgattgtgggatgaagtcgaatcattttgaccaagaagtggtttcaggaaaa
tag

DBGET integrated database retrieval system