KEGG   Halobacteriovorax sp. BALOs_7: BALOs_2401Help
Entry
BALOs_2401        CDS       T05649                                 

Gene name
ddl
Definition
(GenBank) phosphoribosylamine--glycine ligase-like protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
hax  Halobacteriovorax sp. BALOs_7
Pathway
hax00473  D-Alanine metabolism
hax00550  Peptidoglycan biosynthesis
hax01100  Metabolic pathways
hax01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hax00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BALOs_2401 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BALOs_2401 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BALOs_2401 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hax01011]
    BALOs_2401 (ddl)
Enzymes [BR:hax01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BALOs_2401 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:hax01011]
 Precursor biosynthesis
  Amino acid ligase
   BALOs_2401 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C ATP-grasp_3 GARS_A ATP-grasp_4 RimK ATP-grasp ATPgrasp_ST ATPgrasp_Ter ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: AYF45398
UniProt: A0A386Y1L2
LinkDB All DBs
Position
complement(2475235..2476236)
Genome map
AA seq 333 aa AA seqDB search
MSKKKVLVLVHSDLIPPQDISKEEEAREEFEYKPWITEYNVIKTLKSLGHNVKVVGLYSD
LMPLREAIDEFKPNIVFNLLEEFNGNVLFDQNVVSYLELLKVKYTGNNPRGLMIARDKAM
AKKLLSYHRIKTPQFQVFKNRKKTKLSKKLKFPLIVKCLYQDASLGISGASIVKSEEKAL
ERIKYLMDKYEEEVIVEEFIEGREFFVGVIGNKRLTILPILELRFNKVDKPELELYSEKA
KWNMKYRKSKGIDIELADIPKEVKERIIKICKRTYKVLELNGYARIDLRVDENGIPYIIE
ANPNPNIAMKDEFAMAAESAGISYKKLITKLVN
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaaaaagaaagttctcgtacttgtccattcagatctaattccacctcaagatatt
tctaaggaggaggaagcacgggaagagtttgaatataagccttggattactgaatacaat
gttattaagactttaaagagtcttggtcataacgtaaaagtcgtaggtctttattctgac
ttaatgcctcttagagaggccatcgatgaattcaaaccaaatattgtttttaatctactt
gaggaattcaatggtaacgttctctttgatcaaaatgtggtttcctacttagagctactt
aaagttaagtatacaggtaataatccaagaggattaatgattgcacgtgacaaggccatg
gccaagaagcttctttcatatcaccgaataaaaacaccacaatttcaagtctttaaaaat
cgtaaaaaaacgaagctttctaagaagttgaagttcccactaatcgttaagtgcttgtac
caagatgcttcattaggaattagtggagcttcaattgtaaaaagtgaagagaaggcactt
gaacgtattaagtatctcatggataaatacgaagaagaggtcattgttgaagaatttatc
gaaggtcgtgaattctttgtgggagttatcggtaataaacgattaacgattctaccaatt
cttgaacttcgttttaacaaagttgataagcctgaacttgaactctattcagagaaggcc
aaatggaatatgaagtatcgcaaatcaaaaggtatcgatattgagttagcagatattcct
aaagaagttaaagagcgaataataaaaatctgtaagcgaacatataaagttcttgagtta
aatggctatgctaggattgatttacgtgttgatgaaaatgggatcccatatattattgag
gccaatccaaatccaaatatcgccatgaaagatgagtttgcgatggctgcagagtcagct
gggataagctataaaaagttaataacgaaactagttaattag

DBGET integrated database retrieval system