KEGG   Haemophilus sp. oral taxon 036: C3V42_01475Help
Entry
C3V42_01475       CDS       T05707                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
hay  Haemophilus sp. oral taxon 036
Pathway
hay00473  D-Alanine metabolism
hay00550  Peptidoglycan biosynthesis
hay01100  Metabolic pathways
hay01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hay00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    C3V42_01475
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    C3V42_01475
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    C3V42_01475
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hay01011]
    C3V42_01475
Enzymes [BR:hay01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     C3V42_01475
Peptidoglycan biosynthesis and degradation proteins [BR:hay01011]
 Precursor biosynthesis
  Amino acid ligase
   C3V42_01475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 CPSase_L_D2 RimK ATP-grasp_3 ATP-grasp ATPgrasp_ST GARS_A Csa1 TTL ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: AVM59383
LinkDB All DBs
Position
complement(304074..304994)
Genome map
AA seq 306 aa AA seqDB search
MNLKKEKIAVLLGGTSAEREVSLQSGKAVLEALLNQGYNAHPVDPKEYPVANLKNDGFDR
VFNILHGRGGEDGTMQGLLEQIGLPYTGCGVMASALTMDKMRTKMLWKAFGLPVAEMEVV
TRETFNNLNSEEVVARLGLPLMVKPSLEGSSVGLTKVKTVEALKSAVEFALKFDNTILIE
EWLAGDELTVPVLDGKVLPAIRIVPEGEFYDYEAKYISDNTQYFCPAGLTPEREQELALL
VKRAYDAVGCRGWSRIDVMCDSKGNFRLVEVNTNPGMTSHSLFPKSAATVGISFEQLVVK
ILELSA
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaacttaaaaaaagaaaaaattgctgtattactaggcggtacatctgctgagcgagaa
gtgtctcttcaatcagggaaagccgtattagaagctttattgaatcaggggtataacgct
catccagtagatcctaaagaataccctgttgcaaaccttaaaaatgatggttttgatcga
gtatttaatattttacacggtcgtggtggtgaagatggcacaatgcaaggtttattagag
caaattggtttgccttatactggttgtggcgtgatggcttctgcgttgacgatggataaa
atgcgtacaaaaatgctatggaaggcgtttggtttacctgtcgctgaaatggaagtggtt
acgcgtgaaacttttaataatcttaattctgaagaggttgtggcaagactgggcttacca
ttaatggtaaaaccgtctttagaaggatctagtgtgggattaacaaaagtgaaaaccgta
gaagctctaaaaagtgcggtagaatttgcccttaaatttgataatacaattttgattgaa
gagtggcttgctggagatgagttaactgtaccggtattagatggaaaggttttacctgct
attcgtattgtacctgaaggcgagttttatgattatgaggcaaaatacatttcagataat
acacaatatttttgccctgcaggtttaacgcctgaacgtgaacaagaattagcgttatta
gtgaaacgtgcttatgatgcagtaggttgtcgtggttggagccgtattgatgtcatgtgt
gattcaaaaggtaatttccgtttagtggaagtgaatacaaacccaggtatgactagtcat
agtttatttcctaaatcagctgcgacagtcgggatttcttttgagcaacttgtcgtgaaa
attttggagttaagtgcataa

DBGET integrated database retrieval system