KEGG   Haemophilus sp. oral taxon 036: C3V42_01515Help
Entry
C3V42_01515       CDS       T05707                                 

Definition
(GenBank) peptidoglycan synthase
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
hay  Haemophilus sp. oral taxon 036
Pathway
hay00550  Peptidoglycan biosynthesis
hay01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:hay00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    C3V42_01515
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    C3V42_01515
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hay01011]
    C3V42_01515
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hay03036]
    C3V42_01515
Enzymes [BR:hay01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     C3V42_01515
Peptidoglycan biosynthesis and degradation proteins [BR:hay01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   C3V42_01515
Chromosome and associated proteins [BR:hay03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    C3V42_01515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer IF2_N
Motif
Other DBs
NCBI-ProteinID: AVM59390
LinkDB All DBs
Position
complement(314247..316076)
Genome map
AA seq 609 aa AA seqDB search
MVKFNSSRKSNKSKKTIRKLTAPEAVKHNKPKMVFDKCFMRGRYIISVFFVFLGLCALVA
RAGYVQSINADTLSGEADKRSLRKDEILSVRGSILDRNGQLLSVSVPMSAIVADPKTMLK
EDALADKERINALAQEIGMSSNDLIKKIEKNSKSGYLYLARQVESNKADYIKKLNVKGVF
LETEHRRFYPRVEEAAHLVGYTDIDGNGIEGIEKSFNTMLVGKDGSRTVRKDKRGNIVEH
ISDEKKYDAQDVTLSIDEKLQSMVYREIKKAVSENNAESGTAVLVDVRTGEVLAMATAPS
YNPNNRVGVKSELMRNRAITDTFEPGSTVKPLVVLTALQRGVVRRDEVINTGSFTVSGKE
IVDVAPRAQQTLDEILINSSNRGVSRLALRMPPSALMETYQNAGLGKSTDLGLIGEQAGI
LNANRKRWADIERATVSYGYGITATPLQIARAYATLGSFGIYRPLSITKVDPPVIGKRVF
SEKITKDIVGILEKVAIKNKRAMVEGYRVGVKTGTARKLENGHYVNKYVAFTAGIAPISD
PRYALVILINDPKAGEYYGGAVSAPVFSSIMGYALRANGIPQDAEPTEKTMKSAKRIVYV
GERKNEKMN
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atggttaaattcaattcttctcgtaaatcaaataagtctaaaaaaacaattagaaaatta
accgcacctgaagccgtgaaacataacaaaccgaaaatggtgtttgataaatgttttatg
cgtggacgttatattatttcggtattttttgtttttcttggtttgtgtgcattggtagct
cgtgctggttatgtccaatctattaatgctgataccttatctggcgaggcagataaacgc
tcgttacgtaaagatgaaattctttcagtgcgtggttcaattttagatcgtaatgggcaa
ttattatcagtaagtgtcccgatgagtgcaatagtagctgatcccaaaacgatgttaaaa
gaagatgctttagcggataaagagcgtattaatgcattagcacaagagataggaatgagt
agcaatgacttgattaaaaaaattgagaaaaattcaaaatcaggttatttgtatttggct
cgtcaagtagagtcaaataaagcagattatattaaaaaattaaacgttaaaggcgttttc
ttagaaactgaacatcgtcgtttttatccacgtgtagaagaagctgcacatttagttggt
tatactgatattgatgggaatggtatagaagggatagagaaaagttttaataccatgctt
gtggggaaagatggttcacgcacagtacgtaaagataagcgaggtaacattgttgaacac
atttctgatgaaaaaaaatatgatgcgcaagatgttacgttaagtattgatgaaaaatta
caatctatggtgtatcgtgaaattaaaaaagcggtatcagaaaataatgctgaatcaggt
acagctgtattagttgatgttcgtacaggagaagtattagccatggctactgcgccatcc
tataacccgaataatcgtgttggcgttaaatcagaattaatgcgtaatcgtgctattacg
gatacctttgagccgggttctactgtaaagcctttagttgtgttaactgcacttcaacgt
ggtgtagttcgtcgtgatgaagttattaatacggggtcttttacagtaagtggaaaagaa
attgtagacgtagcaccacgtgcgcaacaaacattagatgaaatattaattaattcaagt
aaccgtggtgtaagtcgccttgcgttacgtatgcccccaagtgccttgatggaaacctat
caaaatgcaggtttaggtaagtcgacagatttgggattgattggtgaacaggctgggatt
ttaaatgccaatcgtaaacgttgggcggatattgaacgtgcaacggtttcttatggttat
ggtattactgcaacaccactccaaatagctagagcttatgcaacgcttggtagcttcggt
atttatcgtccactctctattacaaaagttgatccacctgtaatagggaaacgagttttt
tctgaaaaaatcacgaaggatattgtcggtattttagaaaaagtagcgattaaaaataag
cgagcgatggttgaaggatatcgtgttggtgtaaaaacgggtacagcacgtaaattagag
aatggtcattatgtgaataaatacgttgcattcacagcggggattgcaccaattagtgat
ccacgttatgccttagtcattttgattaacgatccaaaagctggggaatattatggtggt
gcggtttcagctcctgtgttctctagtattatgggttatgcattacgtgctaacggaatt
ccacaagatgcggaaccaacagaaaaaacaatgaaaagtgcgaaacgcattgtatatgtt
ggtgagcgtaagaatgaaaaaatgaattaa

DBGET integrated database retrieval system