KEGG   Haemophilus sp. oral taxon 036: C3V42_02820Help
Entry
C3V42_02820       CDS       T05707                                 

Definition
(GenBank) penicillin-binding protein 1A
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
hay  Haemophilus sp. oral taxon 036
Pathway
hay00550  Peptidoglycan biosynthesis
hay01100  Metabolic pathways
hay01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:hay00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    C3V42_02820
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    C3V42_02820
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hay01003]
    C3V42_02820
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hay01011]
    C3V42_02820
Enzymes [BR:hay01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     C3V42_02820
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     C3V42_02820
Glycosyltransferases [BR:hay01003]
 Polysaccharide
  Bacterial polysaccharide
   C3V42_02820
Peptidoglycan biosynthesis and degradation proteins [BR:hay01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   C3V42_02820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB TarH
Motif
Other DBs
NCBI-ProteinID: AVM59622
LinkDB All DBs
Position
577389..579992
Genome map
AA seq 867 aa AA seqDB search
MRIAKLIFSTLLTLCILGLVAGGMLYFHLKSELPSVEALKTVELQQPMQIYTADGKLIGE
VGEQRRIPVKLADVPQRLIDAFLATEDSRFYDHHGLDPIGIARALFVAVNNGGASQGAST
ITQQLARNFFLTPEKTIIRKAREAVLAVEIENTLTKQEILELYLNKIFLGYRSYGVAAAA
QTYFGKSLNELTLSEMAIIAGLPKAPSTMNPLYSLKRSEERRNVVLSRMLDEKYISKEEY
DAALKEPIVASYHGAKFEFRADYVTEMVRQEMVRRFGEENAYTSGYKVFTTVLSKDQAEA
QKAVRNNLIDYDMRRGYRGGAPLWQKNEATWDNERILAFLRKLPDSNPFIPAAVVGMAKG
GADLLLASGEKMTLSTNGMRWTGRSNPVKVGEQIWIRQRTNGEWQLGQIPAANSALVSLN
SDNGAIEAIVGGFSYEQSKFNRATQSLVQVGSSIKPFIYAAALEKGLTLSSVLQDSPISI
QKPGQKLWQPKNSPDRYDGPMRLRVGLGQSKNMIAIRAIQTAGIDFTAEFLQRFGFKRDQ
YFASEALALGAASFTPLEMARAYAVFDNGGFLIEPYIIEKIQDNTGNDLFVANPKIACIE
CNDLPVVYGETKDKINGFANIPLGENALKPSDDSTNGEEVDQQPETVPELPELQSNVTAL
KEDAIDLMAAAKNASSKTEYAPRVISGELAFLIRSALNTAIYGEQGLSWKGTSWRIAQTI
KRNDIGGKTGTTNSAKVAWYAGFGANLVTTTYVGFDDNKRELGKGEAGAKTAMPAWVAYM
KTALSDKPERKLPLPPKIMEKSIDTMTGLLSPSGGRKEYFIVGTEPTRTYVSEMQERGYY
VPPELQQRLNGTGGKAPVPVSQPEELF
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atgcggatcgcaaaattaatatttagtaccctattaactttatgtattttaggtttagtc
gcaggcggaatgctgtatttccacctaaaatcagaattgccctcagtagaagcattaaaa
accgttgaattacaacagccaatgcagatttatacggccgacggtaaattaattggtgaa
gtgggtgagcaacgacgtattccagtgaaattagcagatgtgccacaacgcttaattgat
gcatttttagcgacggaagatagccgcttttacgatcatcacggattagaccctatcggc
attgcccgagcattgtttgttgcagtgaataatggtggcgcatcacaaggtgcaagtacg
atcacccaacaattagcacgtaactttttcttaaccccagaaaaaaccattattcgtaaa
gctcgtgaagccgtgcttgccgtagaaattgaaaataccctcaccaaacaagaaatctta
gaactttatttaaacaaaatctttttaggctatcgttcttatggtgttgcagctgctgca
caaacctatttcggtaaatcattaaatgaattgacgttatcggaaatggctattatcgca
ggcttaccaaaagcgccttcaaccatgaacccgctttattctttaaaacgttcagaagaa
cgccgcaatgtggtgttaagccgaatgttggatgaaaaatacatcagcaaagaagaatat
gatgctgcattaaaagagccaatcgtcgcgagttatcatggtgcaaaatttgaatttcgt
gctgattatgtcactgaaatggtacgccaagaaatggttcgccgttttggtgaagaaaat
gcctacaccagtggttataaagtatttaccactgtactttcaaaagaccaagctgaagca
caaaaagccgtacgtaacaacttaattgattacgatatgcgtcgtgggtatcgtggtggt
gcgcctttatggcaaaaaaatgaagctacttgggataatgaacgtattctagcgttttta
cgtaaattaccagattctaacccatttattccagctgccgtggttggaatggcaaaaggt
ggtgcggatctattattagcatcaggtgaaaaaatgacgctatccactaatggaatgcgt
tggactggcagaagtaatcctgtaaaagtaggtgagcaaatttggattcgtcaacgcact
aatggtgaatggcaattagggcaaattccagcagcaaactctgcgttagtatctcttaac
tcagataatggcgcgattgaagccattgttggtggctttagctatgaacaaagtaagttc
aaccgtgcaacacaatccttagttcaagtgggttcttctattaaaccatttatttacgca
gcggcattagaaaaaggtttaacactttctagcgtattacaagacagcccaatttctatt
caaaaacctggacaaaaattgtggcaacccaaaaactcacctgatcgttacgatggccca
atgcgtttacgcgtaggattaggtcaatccaaaaatatgattgctattcgtgcgatccaa
acggcaggtattgattttacagcagaatttttacagcgttttggctttaaacgtgatcaa
tattttgcaagtgaagccttagcacttggcgcagcctctttcacaccattagaaatggct
agagcttatgcggtgtttgataatggcggtttcctcattgaaccttatatcattgaaaaa
attcaagataacacgggtaatgacttatttgttgcaaaccctaaaattgcttgtattgaa
tgtaatgatctccctgtggtttatggtgaaacgaaagataaaatcaacggctttgcgaat
attcctttaggcgagaatgccttaaaaccatcagatgacagtacaaacggtgaagaagtt
gatcaacaacctgaaactgtgcctgaattgccagaattacagtcaaatgttaccgcactt
aaggaagatgcaattgatttaatggcagcagcaaaaaatgcctcctcgaaaacagaatat
gcgccacgtgtcattagtggcgaacttgcctttctcattcgtagtgccttaaatactgcg
atttatggcgaacaaggtttaagctggaaaggaaccagctggcgtatcgcacaaaccatt
aaacgtaacgatataggcggtaaaacaggtaccaccaatagtgcaaaagtggcttggtat
gcgggatttggtgcaaacttagtcaccacaacttatgttgggtttgatgacaataaacgc
gaattaggtaaaggtgaagcgggtgcgaaaactgcaatgccagcttgggtcgcttatatg
aaaacagcattgagcgacaaacctgaacgtaaattaccattaccaccaaaaattatggaa
aaaagtattgatacgatgactggtttgctctctccatccggtggacgaaaagaatacttt
attgtaggaactgaaccaacccgtacatacgtttccgaaatgcaagagcgtggttactat
gttccaccagaattacaacaacgcttaaatggtactggaggaaaagcgccagtgccagtt
agccagccagaagaactcttctaa

DBGET integrated database retrieval system