KEGG   Halothiobacillus sp. LS2: A9404_01260Help
Entry
A9404_01260       CDS       T04441                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
haz  Halothiobacillus sp. LS2
Pathway
haz00620  Pyruvate metabolism
haz00680  Methane metabolism
haz00710  Carbon fixation in photosynthetic organisms
haz01100  Metabolic pathways
haz01120  Microbial metabolism in diverse environments
haz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:haz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A9404_01260
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    A9404_01260
   00680 Methane metabolism
    A9404_01260
Enzymes [BR:haz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     A9404_01260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ANJ66181
UniProt: A0A191ZE81
LinkDB All DBs
Position
complement(276128..278944)
Genome map
AA seq 938 aa AA seqDB search
MKKQAKNNDKILRARVRLFGNLLGEVLKEQTGEHIFDTVETLRRGFIRLRQKHNPKLHAR
LMTLVRTLDPDTLNFVVRAYGLYFSLVNIAEEDFMHQCRRRQVRLGLRLWSGSFYDTIRE
FSKQKMTPEQLQTLLDRLIYMPVFTAHPTEAKRRTVMDLQRRIFLLCAEMDRPDVMGIER
DRIHRQVKAVILSLLKTNEVRTTRPEVHDEIRLGLYYFRTSIFDAVPLAYRYLERAVDVN
FNEKHPETPVTVPSMFRFGSWIGGDRDGNPYVTHEVTTFAVCSATQTILEEYLERLSAMD
RVLTHSSRLCPEINMAALGLDQDAVDLNLSPLENTGDTFFTEEPYRLKLRVIGQRLQHNL
AYVRGLLNKQPIPLAPEAYANKDLFLADLYRIRDTLIATGDQLLADGDIKDVIRLAETFG
WHLLKLDIRQESTRHTRTVGEILKQLQPKTDYEALGESERLATLTALLGKTKHKAIDMTA
LSEEAAETLTVFKAKRELIDTISRDCFGTYVISMTHAASHVMEVMFLAQLAGLVGKRKNQ
WFCDIQVSPLFETIEDLQQIESVLGTLFENPVYRELLRVSGDLQEVMLGYSDSCKDGGSL
ASTWSLYNAQKRVLNITQKHGIESRLFHGRGGTVARGGGPTHESILSLPYGTVEGQIKFT
EQGEVLSSKYSNTETAIYEITMGATGLMKASAHLVLPRDPIPEAHEQVVAELAEYGERAY
RKLTDETPFFFNYFFEATPVRELGLLNIGSRPASRKVGDLSKASVRAIPWVFGWSESRHT
LPAWYGFGSALQTWREKHGDQQELLTHLFKHWPFFHSMLRNTQLSLTKGEMTIAGEYASL
VTDQEQARQVYGMIREEYFRTLEEVLKVAEAESLVEIDEYIGTSMMRRNPYLDVLNHIQI
VLLRRYRDESEPEADRQKWLPALLRSINAIAAGMRNTG
NT seq 2817 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacaagccaaaaataacgataaaattcttcgtgcccgggtccggctattcggc
aacctgctgggcgaggtgctcaaggaacagaccggcgaacatatcttcgatacagtggaa
accctgcgccggggtttcatccgcttgcgccagaagcacaatccgaaactccacgcacgc
ctgatgactctggtgcgcaccctcgacccggataccctgaacttcgtcgtccgggcctat
ggtctgtacttcagcctggtgaacatcgccgaagaggacttcatgcaccagtgccgccgt
cgccaagtgcgtctcggcctgcgactctggtccggctccttctacgacaccatccgcgaa
ttctccaagcagaaaatgacgccggaacagctgcaaaccctgctcgatcgcctcatctac
atgccggtgttcacggcacaccccacggaagccaagcgccgcacggtcatggatctgcaa
cgccggatcttcctgctctgtgccgaaatggaccgtccggacgtcatgggcatcgaacgc
gaccggatccaccgccaggtcaaggccgtgatcctgtcgctcctgaagacgaacgaagtc
cgcaccacccgccccgaagtgcacgacgaaatccgcctgggcctgtattacttccgcacc
tcgatcttcgatgccgtaccgctggcctatcggtatctggagcgggccgtggacgtcaac
ttcaacgaaaagcacccggaaaccccggtcaccgtacccagcatgttccgcttcggttcc
tggatcggcggggaccgcgacggcaatccctacgtgacgcacgaagtgacgaccttcgcc
gtgtgctcggccacccagacgattctggaagagtacctggagcgcctttccgccatggat
cgcgtgctcacgcattccagtcgcctgtgcccggaaatcaacatggccgcgctgggcctc
gaccaggatgccgtggacctcaacctcagcccgttggaaaatacgggcgataccttcttc
acggaagaaccctatcgcctcaagcttcgcgtcatcgggcagcgccttcagcataatctc
gcctatgttcgtggcttgctcaacaagcaaccgatcccgctggcaccggaggcctacgcc
aacaaggacctcttcctggccgatctctaccgcatccgcgacacgttgatcgccaccggc
gaccaactgctggccgacggcgacatcaaggatgtgatccgactcgcagaaaccttcggc
tggcatctgctcaagctcgacatccgtcaggaatccacccgccacacacgcaccgtcggc
gagatcctcaagcagcttcagcccaaaaccgattacgaagcgcttggcgaatccgagcgg
ctggccacactgaccgccctactcggcaagaccaagcacaaggccatcgacatgacggcc
ctatccgaggaagccgcggagacgctgacggtcttcaaggcgaagcgggaactgatcgac
accatcagccgcgactgtttcggcacttacgtcatttccatgacgcacgcggccagccat
gtgatggaagtcatgttcctggcccagctggccgggctggtcggcaagcgcaagaaccag
tggttctgtgacatccaagtgtccccgctgttcgaaaccatcgaggatcttcagcagatc
gagagcgtgcttggcacgctgttcgaaaaccccgtgtaccgcgaattgctgcgtgtctcc
ggcgacctgcaggaagtgatgctcggttattcggactcctgcaaagatggcggatccctg
gcgtcgacctggagtctgtacaacgctcagaagcgtgttctgaacatcacccagaagcat
ggcatcgaaagccgcctgttccacggtcgcggcgggacggtggcgcggggcggcgggccg
acccacgaatcgatcctgtccctgccctatggcacggtggaaggccagatcaaattcacc
gaacagggcgaagtgctttcctccaagtacagcaatacagaaaccgccatctacgaaatc
accatgggcgccacgggcctgatgaaggcatccgcccatctggttctgccccgggatccg
attccggaggcacacgaacaggtggtggccgaactcgccgaatacggcgaacgcgcctac
cgcaaactcaccgatgaaaccccgttcttcttcaactacttcttcgaggccacccccgtg
cgggaactggggctgctcaacatcggctcacggccggcctcacggaaggtaggtgacctc
tccaaggcctccgtacgcgccattccctgggtgttcggctggtcggaatcccggcatacc
ctgccggcctggtatggcttcggatcggccctccagacctggcgggaaaaacacggcgat
cagcaggaactcctcacccatctgttcaagcactggccgttcttccacagcatgctccgc
aatacccagctttccctgaccaagggcgagatgaccattgccggggagtacgccagcctg
gtcaccgatcaggaacaggcacgccaggtgtatggcatgattcgggaggagtatttccgt
acgctggaagaagtgctgaaggttgccgaagcagaatccctggtcgaaatcgatgaatac
atcggcacgtccatgatgcgccgcaatccttatctggatgtgctgaaccacatccagatc
gtgttgctgcgccggtatcgggacgaaagcgagccggaagcggatcgccagaagtggctg
cctgccctgttgcgatcgatcaatgcgatcgccgcgggcatgcgcaatacaggctga

DBGET integrated database retrieval system