KEGG   Halothiobacillus sp. LS2: A9404_05890Help
Entry
A9404_05890       CDS       T04441                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
haz  Halothiobacillus sp. LS2
Pathway
haz00970  Aminoacyl-tRNA biosynthesis
haz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:haz00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    A9404_05890
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:haz03029]
    A9404_05890
Enzymes [BR:haz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     A9404_05890
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     A9404_05890
Mitochondrial biogenesis [BR:haz03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    A9404_05890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ANJ66972
UniProt: A0A191ZGI9
LinkDB All DBs
Position
complement(1327352..1328824)
Genome map
AA seq 490 aa AA seqDB search
MSLYKQSLAELRAGLDDRRFSARELAEAFLARVAAHDGALNSFISRIPEMALAAADAADA
RIAAGERAPLLGIPYAHKDIFCTQGVRTTCASRMLGDWVAPYDATVHQRLNEAGAVLLGK
TNMDEFAMGSSNENSAFGAVKNPWDHAAVPGGSSGGSAAAVAARLVPWATGTDTGGSIRQ
PAAYCGVTGIKPTYGRVSRFGMIAYASSLDQGGVLAPSAADCAIALRAMAGHDSRDSTSA
DQPVPDYAAELDRPLTGLRIGVPRQWFTDGLDATVAARIEAAIEILVQQGAVRVDIDLPD
AELALAAYYLIAPAEASSNLSRFDGVRFGYRCAEPRDLMDLYERSRSEGFGAEVKRRILI
GTYALSAGYYDAFYGRAQRARRQVSENFAAAFAQCDVIAGPVAPTPAFDLGAHASDPATM
YLEDIYTIPVNLAGLPGMSVPVGFSGARPVGMQLIGAPFTEARLLNVAHRYQQQTDWHQR
VPTAYEEGAA
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
gtgtccttatacaaacaatccctggccgagttgcgtgccggactagacgaccggcggttc
tccgcccgggaactcgccgaggcctttctggcgcgcgtggccgcccatgatggcgcgctc
aacagcttcatttcccggatccccgaaatggcgcttgccgcagcggatgccgccgatgcc
cgcatcgccgctggcgagcgtgcgccattgctcggtattccctacgcccacaaggatatt
ttctgtacgcagggtgtgcgcacgacctgcgcctcgcggatgcttggcgactgggtggct
ccgtacgatgccacggtgcatcagcgcctgaacgaggccggtgccgtgttgctgggcaag
accaacatggacgagttcgccatgggctcctccaacgagaacagtgctttcggcgcggtg
aagaacccctgggatcatgctgcggtgccgggcgggtcgtccggcggttcggcggcagct
gtcgcggcccgactggtgccctgggcgacgggtaccgacaccggcggttcgatccgtcag
ccggcggcctattgcggcgtgacgggtatcaagccgacctatggccgagtctcgcgtttt
ggtatgatcgcctatgcctccagcctggatcagggcggggtgctggccccctcggcagcg
gattgcgccatcgccctgcgggctatggccggacacgattcccgcgactcgacgtctgcc
gatcagcccgtgccggattacgccgccgagctggatcggcccctgaccggtctgcgaatt
ggcgtgccgcgccagtggttcaccgatgggctggatgcgacggtggccgcccggatcgag
gcggcgatcgagattctggttcagcagggtgccgtgcgggtcgacatcgatctgcccgac
gccgagttggcgctggccgcctattatctgatcgcgccggccgaggcctcgtccaacctg
tcccgcttcgacggcgtgcgcttcgggtatcgttgtgccgagccccgtgatctcatggat
ctgtacgagcgcagccggtcggaaggcttcggggccgaagtgaagcgacgcattctcatc
ggcacctatgccctgtcggcaggttattacgatgccttctacggccgggcccaacgggcg
cggcgccaggtgtccgagaatttcgccgcggccttcgcccagtgcgacgtgatcgcgggg
cccgtcgcgccgacacccgctttcgatctgggtgcccatgccagcgatccggccacgatg
tatctggaggatatctacacgattccggtgaatcttgcggggctgcccggcatgtcggtg
ccggtcgggttcagcggtgcacgtccggtcggcatgcagctgatcggcgcgccgttcacc
gaggcgcgactgttgaacgtcgcccatcgataccagcagcagacggactggcatcagcgc
gtgcccacggcttatgaggagggcgcggcatga

DBGET integrated database retrieval system