KEGG   Halothiobacillus sp. LS2: A9404_06280Help
Entry
A9404_06280       CDS       T04441                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
haz  Halothiobacillus sp. LS2
Pathway
haz00630  Glyoxylate and dicarboxylate metabolism
haz00710  Carbon fixation in photosynthetic organisms
haz01100  Metabolic pathways
haz01120  Microbial metabolism in diverse environments
haz01200  Carbon metabolism
Module
haz_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:haz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    A9404_06280
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    A9404_06280
Enzymes [BR:haz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     A9404_06280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: ANJ67041
UniProt: A0A191ZGM8
LinkDB All DBs
Position
1415614..1415946
Genome map
AA seq 110 aa AA seqDB search
MAEMQDYKQSLKYETFSYLPPMSSEQIRAQIKYAIAQGWNPGIEHVEPENTMNHYWYMWK
LPFFGEQSVDNVLAELEACRRAYPTHQIKLVAYDNYAQSQGLAFVVYRGS
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaatgcaggattacaaacaaagtctcaaatacgagaccttctcctatcttccg
cccatgagctcggagcagatccgcgctcagatcaagtatgcgattgcccaaggctggaac
cctgggatcgagcacgtcgagccggaaaacaccatgaaccactactggtacatgtggaag
cttccgttcttcggcgaacaaagcgtggacaacgtcctcgccgagctcgaagcatgccgt
cgggcctatccgactcaccagatcaaactggtggcatatgacaactatgcgcagagccaa
ggcctcgccttcgtggtttaccgcggcagctaa

DBGET integrated database retrieval system