KEGG   Halothiobacillus sp. LS2: A9404_09075Help
Entry
A9404_09075       CDS       T04441                                 

Definition
(GenBank) bifunctional glutamine synthetase adenylyltransferase/deadenyltransferase
  KO
K00982  [glutamine synthetase] adenylyltransferase / [glutamine synthetase]-adenylyl-L-tyrosine phosphorylase [EC:2.7.7.42 2.7.7.89]
Organism
haz  Halothiobacillus sp. LS2
Brite
KEGG Orthology (KO) [BR:haz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    A9404_09075
Enzymes [BR:haz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.42  [glutamine synthetase] adenylyltransferase
     A9404_09075
    2.7.7.89  [glutamine synthetase]-adenylyl-L-tyrosine phosphorylase
     A9404_09075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GlnE GlnD_UR_UTase
Motif
Other DBs
NCBI-ProteinID: ANJ67520
UniProt: A0A191ZI26
LinkDB All DBs
Position
complement(2067183..2069999)
Genome map
AA seq 938 aa AA seqDB search
MVQLPESDYQFLSEAAIVAGADEVTLQQLRVIATVSPFIAQSLKTLPWLWVQLIPLISKP
NHERDLRARFDAWFATRADEEFDRALRQIRRIEMIRIAWRDVCGLADTQETLFDLSQLAD
QSVQQALLFHEAALTARHGSPRDHSGQMQRLVVLGMGKLGGYELNYSSDIDLIFAFEHEG
ETDGERPIANSQFFIKLGQRIIRSLDHVTSDGFVFRVDMRLRPHGDEGALALPFDAMEHY
YATLGREWERYAFIKARVIAGDFAAGETLLNQLKPFVYRKYLDFGAFAQLRDMKKAIEVE
MTRKGLIDNIKLGPGGIREVEFIGQLFQLLRGGREPRLQSRSILKTLDVLGETHQLPASM
IAELKSGYDFLRRTENRLQMQHDQQTQSLPIKDDDRTRLALAMGFDSWQHFLPALDAHRH
RIHRHFGEILKTQRDERRDDDPLLTVWQDDSLSDARAMNHLEHEGFSDPQAALETLRAWK
REHYALVSDIVRQRLDVLIPNLLHEVATGDNAISTLQAVLTLISAVLGRSVYLALLIEQP
QALRQLIQLCSASPWISDLLRQHPILLDELVDPEALYVQPDVDDLCAELDGLLSRFPEDE
ERQFDELRRFRQLSVLRVAAADAMGVLPVMRVSDQLTWIAEVALRAVLNRTRDKLQERYG
RPQATTPEGVIEPGFAIIGYGKLGGIELGYGSDLDLVFLHDSDGEETVTTGPQVIDNSLF
FARIAQKIIHTLSIRTPAGVLYEIDTRLRPDGVGGLLVSSLKGFAQYQQEHAWLWEIQAL
CRARFICGHPPIESAFTAIRKAVICTPRDPNMLRSEIRAMREKMRAEQDSPPPDHFHLKR
GVGGITDIEFIVQYLLLRHAHAHPEIIRFTDNIRQLTALMNEKVLPEAIGSALITAYQSL
RNATHRRTLANQSLNVPIADFASERATVMATWQHYFTD
NT seq 2817 nt NT seq  +upstreamnt  +downstreamnt
atggttcaattgcctgagtccgattaccagtttctttctgaagcggccattgtggccggc
gcggacgaagtgaccctacagcagctccgcgtgatcgccacggtcagtccctttatcgcc
cagagcctcaagaccttgccctggctctgggttcagctcattcccctgatttccaaaccg
aatcacgagcgcgatctccgggctcgatttgacgcctggtttgcgacacgtgctgatgaa
gagtttgaccgggccctccgtcagatccgacgtatcgaaatgatccgtattgcctggcgg
gatgtctgtggtctggctgacacgcaggaaacgctttttgacctgtcgcaactggcggac
caaagtgttcagcaagcgctactctttcatgaagccgctctgacggcccgtcatggcagc
ccccgggatcactcgggccaaatgcaacgtctggtcgtgctgggtatgggtaagctcggt
gggtatgagctgaattactcctcggacatcgatctcattttcgcctttgagcacgaaggt
gaaacggatggcgaacgtccgattgccaatagtcagttcttcatcaagctcgggcaacgc
atcatccgctccctggatcatgtgacaagcgacggtttcgtctttcgggtcgacatgcgc
ctgagaccccatggcgacgagggtgccctggcgcttccctttgatgccatggagcactac
tacgccacgctaggtcgtgaatgggagcgttacgccttcatcaaggctcgggtcatcgca
ggggactttgctgccggagaaactctgctcaaccaactcaaaccgttcgtctatcgaaag
tacctggacttcggtgcgtttgcccaacttcgggacatgaaaaaggccatcgaagtggaa
atgacccgaaagggcctgatcgacaacatcaagcttgggccaggaggcattcgtgaagtg
gagttcatcggccagttgttccagctgctccgcggaggaagggaaccgcgtctgcagagc
cggagtattctgaagaccctcgatgttctgggagagacgcatcagctgcctgcatcgatg
attgccgagctcaagtctggctatgacttccttcggcgcaccgaaaaccggcttcagatg
caacacgatcaacaaacccaatccctgccgattaaggacgatgatcgtacccgtctggcc
ctggcgatggggtttgatagctggcagcactttctcccggccctcgacgcgcaccggcac
cgcattcatcgacatttcggcgagattctcaagacccagcgcgacgagcgacgcgacgat
gaccccttgctcactgtgtggcaggacgacagcctgtcagatgcacgggccatgaatcat
ctcgagcacgagggtttttccgacccacaggctgccctagaaaccctacgcgcctggaaa
cgtgaacactatgcgcttgtcagtgacatcgtccgccagcgcctcgatgtactgataccc
aatcttcttcacgaagttgcaactggcgacaatgccatttcgacacttcaggctgtcctg
accctcattagcgccgtgctgggaagatcagtttacctggcactgctgatcgagcaaccc
caggcgctccgtcaactcattcaactctgctcggcgagtccttggatttccgatcttctg
cgacaacaccccatccttctggatgaacttgtcgatcccgaggctttgtacgtccagccc
gacgtggatgatctttgcgccgaactcgatggtctgttatcccgtttccccgaagacgag
gagcgacagttcgatgaactgcgccgtttccgtcaactctccgtactgcgcgttgcggcc
gcggacgccatgggggtgcttcctgtcatgcgggtatccgatcagctgacctggatcgca
gaagttgcacttcgtgccgtgctgaaccgtacccgggataaattgcaggagcgctatggc
cgcccgcaggctaccaccccggaaggcgtcatcgaacccggatttgccatcatcggctat
ggcaagctgggcggcatcgaactggggtatggctcggatctggatctcgtcttcctgcat
gactcggatggtgaggagacggttaccacggggccgcaggtcatcgataacagtctcttc
ttcgcccggattgcccagaaaatcatccataccctgagcatcaggacaccggcgggcgta
ctctatgaaattgatacccggcttcgaccggatggtgtcggcgggctgcttgtctccagt
ctaaagggattcgcgcaataccagcaggagcatgcctggctttgggaaatccaggctttg
tgtcgtgcccgtttcatctgtggtcatccgcccatcgaatctgcctttaccgccattcgg
aaagccgtgatctgtaccccccgtgacccgaacatgctgcggtccgagattcgtgcgatg
cgggaaaaaatgcgggccgagcaggatagccccccgcccgatcatttccatctcaaacgc
ggtgttggggggattacggatatcgagttcatcgttcaatatctcctgctgcgccatgca
cacgcccacccggagattattcggttcacggacaatattcgtcagctgaccgcgctcatg
aacgagaaggtcctgccagaagccatcggatcggcgctgattaccgcctatcagtcattg
cgcaacgcaacacaccgccgaacgttggccaaccagtccttgaatgtgcccatcgccgat
ttcgcgtccgaacgggcgaccgtcatggccacctggcaacattatttcaccgactag

DBGET integrated database retrieval system