KEGG   Halothiobacillus sp. LS2: A9404_09265Help
Entry
A9404_09265       CDS       T04441                                 

Definition
(GenBank) uracil-DNA glycosylase
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
haz  Halothiobacillus sp. LS2
Pathway
haz03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:haz00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    A9404_09265
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:haz03400]
    A9404_09265
Enzymes [BR:haz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     A9404_09265
DNA repair and recombination proteins [BR:haz03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     A9404_09265
 Prokaryotic type
     A9404_09265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG Cu-oxidase_2
Motif
Other DBs
NCBI-ProteinID: ANJ67552
UniProt: A0A191ZI73
LinkDB All DBs
Position
2105391..2106080
Genome map
AA seq 229 aa AA seqDB search
MTEAPPLEPGWWAQLASVFATPPIDRLRDFLRTELRSGKQLLPAKTDWFNAFAATPFDRV
RVVILGQDPYPTPGHAHGLSFSVRRDVRPLPKSLVNIFQELADDLGIRNTSGDLTPWADQ
GVLLLNAVLTVPARQPAGHQNQGWELITDAAISALAAREKPVVFVLWGAAAQRKAALIAP
HNHNQRHLIIQSPHPSPLSAYRGFFGSRPFSRINDFLQQHGEPPIDWRT
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaggcgccaccgctcgaaccgggctggtgggcgcagctggcctcggtattcgcc
acgccgcccatcgatcgtctgcgggatttcctgcgcacggaactgcggtcgggaaagcag
ttgctgcccgccaagacggactggttcaatgccttcgccgccacgcccttcgaccgggtg
cgggtagtgattctcggtcaggacccctaccctacgccgggtcacgcccatgggctcagt
ttctcggtccggcgggacgtgcgccccctgcccaagtcgctggtgaacatcttccaggag
ctggcggacgatctcggcatccgcaatacctccggggacctcacgccctgggcggatcag
ggcgttctgctgctgaacgcggtgctcaccgtcccggcgcgacaaccggcgggtcatcag
aatcagggctgggaattgattaccgatgcggcaatcagtgcgctggccgcgcgggaaaaa
cccgtggtgttcgtcctctggggggcggcggcccagcgaaaggcggccctgatcgccccg
cacaaccacaaccagcgtcatctgatcatccagagcccccacccctccccgctctccgcc
tatcgcggctttttcggttcgcggccgttctcgcgcatcaacgactttctacagcagcac
ggcgagccgcccatcgactggcgcacctga

DBGET integrated database retrieval system