KEGG   Hirschia baltica: Hbal_0394Help
Entry
Hbal_0394         CDS       T00945                                 

Definition
(GenBank) UDP-N-acetylmuramate/alanine ligase
  KO
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
hba  Hirschia baltica
Pathway
hba00471  D-Glutamine and D-glutamate metabolism
hba00550  Peptidoglycan biosynthesis
hba01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hba00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Hbal_0394
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Hbal_0394
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hba01011]
    Hbal_0394
Enzymes [BR:hba01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     Hbal_0394
Peptidoglycan biosynthesis and degradation proteins [BR:hba01011]
 Precursor biosynthesis
  Amino acid ligase
   Hbal_0394
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase Mur_ligase_C Arteri_nsp7a
Motif
Other DBs
NCBI-ProteinID: ACT58096
UniProt: C6XMF3
LinkDB All DBs
Position
422305..423729
Genome map
AA seq 474 aa AA seqDB search
MKNPSPFDLGPAHLVGIGGIGMSGIAEIMLTMGYQVQGSDMREGPNLDRLRKKGARIFIG
HEAENVANAGAVIISSAIKAGNPEVDAARAAGIPVVRRANMLAELVRMKWTVCVAGTHGK
TTTTTMVSSLLDAADIDPTVINGGIVNAYGSNAKAGAGDWMVLEADESDGTFTKLSPTAA
IVTNIDPEHMEHYGSMENLRAAFDTFVENIPFYGFAVLCTDHPEVQALASRIVDRRRITY
GFNRQADVRAVNLRTDLKGAHFDIALRRPGSATPRMIKGATLPMAGDHNVQNALAAVTVA
LELGASDDQILAGLSGFGGVKRRFTPAGEWEIEAGKEPVRIIDDYGHHPVEIEAVLKAAR
SMQGQGGVIAVAQPHRYSRLNDLFSEFSTCFDMADIVLIPPVYEAGETPIEGINHETLVK
SIRQHGHKDVGILESLEALPEAIKAYAKPGDMVVCLGAGDITNYANSLAENLKK
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacccatcaccatttgacctcggccccgcacatcttgttggtattggcggaatt
ggaatgtccggtatcgctgagatcatgctcaccatgggatatcaggttcaagggtctgat
atgagggaaggcccaaatctggaccgtcttcgtaaaaaaggtgctaggatcttcattggt
catgaagcggaaaatgttgctaatgctggtgcggtgattatttcttcagctattaaagcg
ggaaaccctgaagttgatgcggcgcgtgctgcggggattccggtggttcgccgcgcaaac
atgctggcggaattagtgcgtatgaaatggaccgtttgtgtcgctggtacgcatggaaaa
acgacaaccacaactatggtgtcatctttgctggatgctgccgatattgaccctaccgtt
atcaatggcggtattgtgaatgcatatggatcaaatgccaaagcgggtgcaggtgactgg
atggtacttgaggctgatgaaagcgatggtacttttaccaagctttcgccaacggctgcc
atcgttacgaatatagaccctgaacacatggagcactatggctctatggaaaatctacgg
gctgcttttgatacatttgttgaaaatattcccttttatggctttgctgttttgtgtacg
gaccatcctgaagtgcaggcgcttgcatcgcgaattgtggaccgccgccgcattacttat
gggttcaaccgtcaggcggatgtacgtgcagttaatctaagaacagatttaaaaggcgca
cattttgatattgcgctacgtcgccctggttctgcgacaccgcgcatgattaaaggtgca
actttgccaatggcgggcgatcataatgtgcaaaatgctctagctgctgtcacagttgcg
ctagagcttggtgcaagtgatgatcaaatccttgcaggtctttctggctttggcggcgtc
aagcgtcgtttcacgccggcaggggagtgggaaatcgaagcaggcaaagagcctgtccgc
attattgacgattatggacatcaccctgttgagattgaagctgtgctcaaggctgcgcgg
tccatgcaaggccaaggcggcgtaatcgcagttgcgcaacctcaccgatattcacgtttg
aatgaccttttctcagagttttcaacctgctttgacatggctgatattgtgttgatcccg
cctgtgtatgaagccggagaaacaccaattgaaggcataaatcacgagacgcttgtgaaa
tctattcgtcagcatggccataaagatgttggtattcttgaaagtttagaagcactccca
gaagccataaaagcgtatgcaaagccgggtgatatggtcgtatgtttgggagcgggtgac
atcacaaattatgcaaattcactggcggaaaacctgaagaaatag

DBGET integrated database retrieval system