KEGG   Hirschia baltica: Hbal_1299Help
Entry
Hbal_1299         CDS       T00945                                 

Definition
(GenBank) Beta-ketoacyl synthase
  KO
K00647  3-oxoacyl-[acyl-carrier-protein] synthase I [EC:2.3.1.41]
Organism
hba  Hirschia baltica
Pathway
hba00061  Fatty acid biosynthesis
hba00780  Biotin metabolism
hba01100  Metabolic pathways
hba01212  Fatty acid metabolism
Module
hba_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:hba00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Hbal_1299
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Hbal_1299
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hba01004]
    Hbal_1299
Enzymes [BR:hba01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.41  beta-ketoacyl-[acyl-carrier-protein] synthase I
     Hbal_1299
Lipid biosynthesis proteins [BR:hba01004]
 Fatty acid synthase
  Component type
   Hbal_1299
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ketoacyl-synt_C ketoacyl-synt Thiolase_N ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ACT58991
UniProt: C6XIP6
LinkDB All DBs
Position
1365536..1366696
Genome map
AA seq 386 aa AA seqDB search
MSTIYINAFSTCSRLGMNRDETLKSLKSALPPRPDKDAQLAGGATTKVAALATDLPNDQS
GETRTNQITAYLISQMQEEIAQTLAKYGSERVAGIIGTSTTGVEEAINPLDDRIKNGEWD
DDYDFTNQELGDTAQFLKNSIGFTGPCHTVSTACTSGSKALAAAARFINAGLADAVICGG
VDSLSRLTTNGFSALDSVSSQMCAPFSKNRCGINIGEGGALFIVSKDVGPWKLSGWGESS
DAYHMSSPEPSGAGAELALNEAMSRANLKPENINFVHMHGTSTPLNDAMESTLVNRVFGP
NMPCASTKGMTGHTLGAAGALQAAINIIALDEQIYPPHIYDGQWDDDLAPINLTSVQSQP
DQPITATLSASYAFGGSNIALIIEKA
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgagtacgatttatatcaacgcattttcaacatgctctcgactaggcatgaaccgagat
gaaaccttaaaaagcttaaagtctgctctaccgccgcgtccagataaggacgcacaattg
gctggtggtgcaacgacaaaagtcgccgcgcttgcaactgatttacccaatgatcaaagc
ggtgaaacgcgaaccaatcagatcacagcctatctgatttcacaaatgcaggaagagatc
gcacaaacactcgcaaaatatggctctgagcgtgtcgccggtataatcggcaccagcaca
accggcgtggaagaagctatcaatccgcttgatgatcgcatcaaaaacggtgaatgggat
gacgattatgatttcactaatcaggaattaggcgacacagcgcaatttttaaaaaacagc
attggttttaccggtccatgccacactgtttcaacggcctgcacgtcaggttcaaaagct
ttggctgcggcagcacgattcatcaatgcaggtttagcagatgctgtcatttgcggcggt
gttgattcgttatcgcgtttaacaacaaatggttttagtgcacttgatagtgtgtcttcc
caaatgtgtgcgccatttagcaaaaacagatgcggcattaatataggtgaaggcggggca
ttatttattgtctcaaaagatgttggtccatggaaattatctgggtggggcgaaagctca
gatgcctatcatatgtcatctccggagccttctggtgcaggtgcagaattagccttgaac
gaggccatgtcccgcgcaaaccttaaaccagaaaatataaactttgtgcacatgcacggc
acatcaacaccactcaatgatgcaatggagtcaacacttgtgaaccgtgtgtttggcccc
aatatgccctgtgcgtccactaaaggcatgacaggccacacattgggcgctgctggtgca
ttgcaagctgcaatcaatataatcgccctagatgagcaaatttatcccccgcatatctat
gatgggcagtgggatgatgatctagcgccaataaatttaacctctgttcagagccagcca
gatcaacctataacagccactttgagtgcaagctatgcatttggtggtagtaatattgcg
ctgattatcgagaaggcctga

DBGET integrated database retrieval system