KEGG   Hirschia baltica: Hbal_1410
Entry
Hbal_1410         CDS       T00945                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
hba  Hirschia baltica
Brite
Enzymes [BR:hba01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Hbal_1410
SSDB
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Other DBs
NCBI-ProteinID: ACT59101
UniProt: C6XJ06
LinkDB
Position
complement(1474555..1475145)
AA seq 196 aa
MAFELPALPYATDALEPHMSANTFSFHHAKHHNAYVTNLNKMIEGTDFAGKSLEEIIKSS
DGGVFNNAAQVWNHTFFWHSMKPQGGGEPTGAIADKINADFGSYAAFKEAFATAGATQFG
SGWAWLVLANGKLEVRKTPNAETPLTEDGVTPLLTMDVWEHAYYLDYQNARPVYIETFLS
ELVNWDFVNQNLADAS
NT seq 591 nt   +upstreamnt  +downstreamnt
atggctttcgaacttcctgcactcccatacgcaacagatgcactagaacctcacatgtct
gcgaacacttttagctttcaccacgcaaagcatcacaacgcatatgtgacaaatttgaat
aagatgattgaaggcactgacttcgcaggcaaatcacttgaagaaatcatcaagtcttct
gatggcggtgtatttaacaatgcggctcaagtgtggaaccacacattcttctggcactca
atgaaaccacaaggtggcggcgagccaactggtgcgatcgccgacaagatcaatgcagat
tttgggtcttatgctgcatttaaagaagctttcgctacagctggtgcgactcaatttggt
tctggttgggcttggcttgtccttgcaaacggcaaactagaagtgcgcaaaactccaaat
gctgaaacacctcttacagaagacggtgtaacaccgcttctaaccatggatgtttgggag
cacgcatattacctagattaccagaacgcacgtccagtttacattgaaacctttcttagc
gaactcgtgaattgggacttcgtaaaccagaacttggcagacgctagctag

DBGET integrated database retrieval system