KEGG   Hirschia baltica: Hbal_2713Help
Entry
Hbal_2713         CDS       T00945                                 

Definition
(GenBank) PfkB domain protein
  KO
K00874  2-dehydro-3-deoxygluconokinase [EC:2.7.1.45]
Organism
hba  Hirschia baltica
Pathway
hba00030  Pentose phosphate pathway
hba01100  Metabolic pathways
hba01120  Microbial metabolism in diverse environments
hba01200  Carbon metabolism
Module
hba_M00061  D-Glucuronate degradation, D-glucuronate => pyruvate + D-glyceraldehyde 3P
Brite
KEGG Orthology (KO) [BR:hba00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Hbal_2713
Enzymes [BR:hba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.45  2-dehydro-3-deoxygluconokinase
     Hbal_2713
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-ProteinID: ACT60386
UniProt: C6XQ87
LinkDB All DBs
Position
2970922..2971935
Genome map
AA seq 337 aa AA seqDB search
MARIVCFGEMLLRLSSPARERLFQSDKLDTNFVGAEANVGVTLSRMGNDVSMVTVLPDNA
IGDACCDTLHKHAVETKNIVRQGERMAIYFLETGAMIRPSAITYDRKYSAFSQAKGDIFN
WNEILKGADWLHLSGITLAVSEGAQKASLAAAQAARKLGVKISFDCNYRPSLWTGREAEG
IKIIKDVAAHADLIFGGDKDVQLLFGISRNAENPTVSFQAAAQEFFKHCKHVSHICSTNR
TVISADSNTLAGFIASRDGFAQTKSWDLFNIVDRIGGGDAFAGGALHKLASGAPLQDIID
FAVATSAVKHTIPGDFNITTEAEVSAMLSSSGGDVKR
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
ttggcacgtattgtatgttttggcgaaatgctcctccggctcagctcacccgcgcgcgag
cgcctttttcaatcagataagctcgacacaaatttcgtcggggcggaagccaatgtcggt
gtcacactttcccgcatgggaaatgatgtttcaatggtgactgttttgccagacaatgca
attggtgatgcgtgctgcgatacccttcacaagcacgcagtcgaaactaaaaacatcgtc
cgccaaggtgagcgaatggcgatctattttctggaaactggtgcgatgatccgcccctct
gccattacttatgatcgtaaatattccgcattctctcaagccaaaggcgatatttttaat
tggaacgaaattcttaaaggcgcagactggttacacctttcaggcatcacactcgcggtg
agcgaaggcgcacaaaaagcaagtctagcagctgcgcaagccgctcgaaaacttggtgtt
aaaatttcattcgattgcaattatcgcccctctctttggaccggacgagaagctgaaggc
ataaaaatcatcaaagacgttgcagcacatgctgacttaatttttggtggcgataaagac
gttcagctattatttggtatttcacgcaatgctgaaaacccaactgttagcttccaagct
gcggcacaggaattcttcaaacactgtaaacacgtctcacatatttgtagcacaaaccgc
acagttattagtgctgactctaacactttagctggttttattgcgtccagagatggcttc
gcccagacaaaatcatgggatttattcaacattgtcgaccgtataggtggtggtgatgca
tttgcgggtggcgcacttcacaagctcgcatcaggtgcaccgcttcaggacatcatagat
tttgctgtcgccacctcagccgtcaaacacacaattcctggagatttcaacatcacaact
gaagctgaagtctcggctatgctgtccagctccggcggtgatgtaaaacgctaa

DBGET integrated database retrieval system