KEGG   Hyphomonadaceae bacterium UKL13-1: AEM38_07465Help
Entry
AEM38_07465       CDS       T04338                                 

Definition
(GenBank) hypothetical protein
Organism
hbc  Hyphomonadaceae bacterium UKL13-1
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AMS29331
LinkDB All DBs
Position
complement(1609484..1609951)
Genome map
AA seq 155 aa AA seqDB search
MKATPANVQRLRLIGRVPMMLALGLIVLPLGACQTLGQEEGFLPDTIRSASAVLKPGDYP
DLSKIPDAPTNLPSQKSWADLQAGLQADAKIMQANPGSKPVAAGEIDQTWAKAEKQAIET
NTASAQTTQTNAESDAWAAAARAKMEADIARLPPT
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgacaccagccaacgtccaacgcctacgcctgatcgggcgcgtgccgatgatg
ctcgcgctggggctcattgtcctgccgctcggtgcgtgtcagacgctcggccaagaggaa
ggttttttgcccgacacgatccgctccgccagtgccgtcctgaagcccggtgactatcca
gatttaagtaagatcccagacgccccaacaaatttgccaagccaaaagtcttgggccgat
ttgcaggcaggtttgcaggctgatgctaagattatgcaagccaatcccggttccaagcca
gttgctgccggtgagatcgatcagacttgggcaaaggctgaaaagcaagcgattgagaca
aatactgcctcagctcagaccacccaaaccaacgcggagtccgacgcttgggcggcagcc
gcacgagctaaaatggaggcggacatcgcgcgtctgcctccaacctag

DBGET integrated database retrieval system