KEGG   Hyphomonadaceae bacterium UKL13-1: AEM38_11950Help
Entry
AEM38_11950       CDS       T04338                                 

Definition
(GenBank) succinate dehydrogenase
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
hbc  Hyphomonadaceae bacterium UKL13-1
Pathway
hbc00020  Citrate cycle (TCA cycle)
hbc00190  Oxidative phosphorylation
hbc00650  Butanoate metabolism
hbc01100  Metabolic pathways
hbc01110  Biosynthesis of secondary metabolites
hbc01120  Microbial metabolism in diverse environments
hbc01130  Biosynthesis of antibiotics
hbc01200  Carbon metabolism
Module
hbc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hbc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
hbc_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:hbc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AEM38_11950
   00650 Butanoate metabolism
    AEM38_11950
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AEM38_11950
Enzymes [BR:hbc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AEM38_11950
    1.3.5.4  fumarate reductase (quinol)
     AEM38_11950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_18 Fer4_9 Fer2 Fer4_16
Motif
Other DBs
NCBI-ProteinID: AMS30003
LinkDB All DBs
Position
complement(2556578..2557360)
Genome map
AA seq 260 aa AA seqDB search
MVQLTLPANSRVTKGKHYPAPAGAKKVRTFKIYRYDPETGQNPRWDTYDVAVDQCGPMVL
DALIHIKSTMDATLTFRRSCREGVCGSCAMNIGGRNTLACTKGHDEIPGDTLSVSPLPHM
PVIKDLVPDLTNFYAQYASIEPYMQTTTPAPEKEWKQSPEDREKMDGLYECILCACCSTS
CPSYWWNGDRYLGPAVLLQAYRWLIDSRDEEKGKRLDNLEDPFRLYRCHTIMNCAQVCPK
GLNPAKAIGEIKTMMVERAL
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggtacagcttacacttccagccaattctcgggtgaccaagggcaagcattatcctgcc
cctgccggcgctaagaaagtgcggacgtttaagatttaccgctatgacccggagacgggc
cagaatccgcgctgggacacctatgacgtcgccgtcgatcaatgcggcccgatggtgctg
gacgcgctgatccatatcaaaagcacgatggatgcgaccttgaccttccgccgctcgtgc
cgcgaaggtgtgtgcgggtcgtgcgcgatgaacattggcgggcgcaacaccttggcctgc
accaagggccatgacgaaattccaggcgacactttgtcggtcagcccgctgccacatatg
ccggtgatcaaggacttggtgccggaccttaccaatttctatgcccaatatgcttccatc
gagccatatatgcagacgacgacgcctgcgcctgagaaggaatggaagcaaagcccagaa
gaccgtgaaaagatggacggtctgtacgagtgcatcttgtgcgcctgttgctccacctct
tgcccatcctattggtggaatggcgaccgctatttgggccccgcggttttgctgcaagcc
tatcgttggctgatcgacagccgcgacgaggaaaagggcaagcgtctcgataatctggaa
gacccattccggctctatcggtgccatacgatcatgaactgcgcccaagtctgtccaaag
ggcctcaatcccgccaaggcgattggcgagatcaagactatgatggtcgagcgcgcgctt
taa

DBGET integrated database retrieval system