KEGG   Halomonas beimenensis: BEI_0298Help
Entry
BEI_0298          CDS       T05125                                 

Definition
(GenBank) hypothetical protein
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
hbe  Halomonas beimenensis
Pathway
hbe00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:hbe00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BEI_0298
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hbe01002]
    BEI_0298
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hbe01011]
    BEI_0298
Enzymes [BR:hbe01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BEI_0298
   3.4.21  Serine endopeptidases
    3.4.21.-  
     BEI_0298
Peptidases and inhibitors [BR:hbe01002]
 Serine peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   BEI_0298
Peptidoglycan biosynthesis and degradation proteins [BR:hbe01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   BEI_0298
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13 Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: ATJ81285
UniProt: A0A291P341
LinkDB All DBs
Position
308385..309827
Genome map
AA seq 480 aa AA seqDB search
MPFRLLACCLLCLLPLVTQAQGFARLAELAEDGFRIGAEARLLGNGEPGETLGSIEPRLA
LSPASVSKVYVAAAALDRFGPQHRFTTRLVGTAEPDAAGVLDGDLILDGGGDPALTTEDL
WRLVQRLHQAGVREVTGRLVISQWRFGPVTCITTDRCEGQHRVDNAYSALLSSAAINYGN
WCVTVAPARMPGEPAVVTSCDSQTRLPAIDNRVETKPDDSGTRLTAERLTRDGADVMRVG
GQISTNAHPREIYRTSSDPAGQTAELLMAMLDQAGIPVAGGAVTTALEPPDTAHRLAAVD
GEPLQELLLRTLNYSNNFMADTLALDLAEVPRPNLVQAGDAIEAFARGLPGHGEVRLDSG
SGLTPENRTTAAGVNVLLESLFRRPALFPSFVAALQSPGNGVMRFIRRGSETFQHHVMLK
TGTLNQPVTVRAVAGYFRTRTGRWGVFSVLINGTASTPYLSWSTVLDRLSVDLDAMIASH
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgccgtttcgtctcctcgcctgctgcctgttgtgcctgctgcccctggtgacccaggcc
caggggttcgcccgtctcgccgagctggccgaggacggcttccggatcggtgccgaggcc
cgcttgctgggcaacggcgagccgggcgagacgctcggcagcatcgaaccgcggctggcc
ctgtcgccggcctcggtgtccaaggtctacgtggcggcggcggccctggaccgcttcggc
ccccagcatcgcttcaccacccgcctggtcggcaccgccgagccggatgcggcgggcgtg
ctggacggcgacctgatcctcgacggcggcggtgacccggcgctgaccaccgaggacctg
tggcggctggtgcagcgcctccaccaggccggggtgcgcgaggtaaccgggcgccttgtg
atcagccagtggcgcttcggcccggtgacctgcatcaccaccgaccgctgcgagggccag
catcgggtggacaacgcctacagtgccctgctgtcctcggcggcgatcaactacggtaac
tggtgcgtcaccgtggccccggcgcggatgcccggcgagccggcggtggtgaccagctgc
gacagccagacccggctgccggccatcgacaaccgggtggagaccaagcccgacgacagc
ggcacccggctcacggccgaacgcctgacccgcgacggcgccgacgtcatgcgcgtcggc
ggccagatctccaccaacgcccatccccgggagatctatcgcaccagctccgaccccgcc
ggacagaccgccgaactgctgatggccatgctcgaccaggccggcatcccggtggccggc
ggcgcggtcaccaccgccctggagccccccgacacggcgcatcggctggccgcggtggat
ggcgagccattgcaggaactgctgctgcgtaccctcaactactccaataacttcatggcc
gataccctggccctggacctggccgaggtcccgcggccgaacctggtgcaggccggcgac
gccatcgaggccttcgcccggggcctgccgggccatggggaggtgcgcctggacagcggc
agcggcctgaccccggagaatcgcaccaccgccgccggcgtgaacgtgctgctggagagc
ctgttccgccgccccgcgctcttccccagcttcgtggccgcgctgcagtcgcccggcaac
ggcgtgatgcgcttcatccggcgcggctcggagaccttccagcaccacgtcatgctcaag
accggcaccctcaaccagccggtgacggtccgcgcggtggccggttacttccgcacccgc
acgggacgctggggagtgttctcggtgttgatcaacggcaccgcctcgacgccctacctg
agctggtccacggtgttggatcggctctcggtggacctcgacgccatgatcgcgtcacat
tga

DBGET integrated database retrieval system