KEGG   Halomonas beimenensis: BEI_0346Help
Entry
BEI_0346          CDS       T05125                                 

Gene name
ligD1
Definition
(GenBank) ATP-dependent DNA ligase clustered with Ku protein, LigD
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
hbe  Halomonas beimenensis
Brite
KEGG Orthology (KO) [BR:hbe00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    BEI_0346 (ligD1)
Enzymes [BR:hbe01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BEI_0346 (ligD1)
DNA repair and recombination proteins [BR:hbe03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     BEI_0346 (ligD1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: ATJ81333
UniProt: A0A291P371
LinkDB All DBs
Position
complement(362956..363885)
Genome map
AA seq 309 aa AA seqDB search
MQIDGRHIETSNRDKPFFPEAGLTKGDLVDYYADLGDTMLVHLDGHPVSLQRFPDGLDGE
GFYQKDASAHFPDWLTRVRFPKREGGHFMAPVIDSRAALVYLADQAMITPHPYLARADDL
ERPDRLIFDLDPPEGGRDVASVRRAALDLRGLLDELSLSAWVQTTGSRGFHVVVPLDAGA
DFDASRAFARDTARVLVRRHPDRYTLAQRKRQRRGRIFLDVMRNAYGATAVAPYAVRALA
GAPVATQLSWPELERGATPRGWTLGNLRRRLAQKADPWAEMARHAVALSAHREALDRLLA
REPPAEEEA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgcagatcgatgggcggcacatcgagacctcgaaccgcgacaagccgttcttccccgag
gcgggactcaccaagggcgacctggtcgactactacgccgacctcggcgacaccatgctg
gtgcacctcgacggccacccggtcagcctgcagcgcttccccgacggcctcgacggcgag
ggcttctaccagaaggacgcctcggcccactttcccgactggctgacgcgggtgcgcttc
cccaagcgcgagggcggccacttcatggcgccggtcatcgacagtcgcgcggccctggtc
tacctggcggaccaggcgatgatcactccgcacccctacctggcccgggccgacgacctc
gagcgccccgaccggctgatcttcgacctggacccgcccgagggcggccgggacgtcgcg
tcggtgcggcgtgccgccctggacctgcgcggcctgctggacgaactgtcgctgagcgcc
tgggtgcagaccaccggttccaggggcttccatgtggtggtgccgctcgacgccggcgcc
gacttcgacgccagtcgcgccttcgcccgggacaccgctcgggtactggtccgccgccac
cccgatcgctacaccctggcccagcgcaagcgccagcggcggggacggatcttcctggac
gtcatgcgcaacgcctacggcgccaccgcggtggcgccctatgccgtgcgcgccctggcg
ggcgcgcccgtcgccacgcagctgtcctggccggagctggaacgcggggccaccccccgg
ggctggaccctgggcaacctccgccgtcgcctggcccagaaggcggacccctgggccgag
atggctcgccacgccgtcgcgctctccgcccatcgtgaggccctcgaccgcctgctggcg
cgcgagccgcccgccgaggaggaagcctga

DBGET integrated database retrieval system