KEGG   Halomonas beimenensis: BEI_1438Help
Entry
BEI_1438          CDS       T05125                                 

Definition
(GenBank) 2,3-butanediol dehydrogenase, R-alcohol forming, (R)- and (S)-acetoin-specifi
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
hbe  Halomonas beimenensis
Pathway
hbe00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:hbe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BEI_1438
Enzymes [BR:hbe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BEI_1438
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BEI_1438
    1.1.1.-  
     BEI_1438
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc ADH_zinc_N_2 DAO AlaDh_PNT_C 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ATJ82425
UniProt: A0A291P6B5
LinkDB All DBs
Position
1513005..1514075
Genome map
AA seq 356 aa AA seqDB search
MNTMQAAVWHGRQDVRLETVPRPAAPAAGWVQVRVHWCGICGSDLHEYLAGPVFIPVDAP
HPLTGAQGRCILGHEFCGEIVAVGEGVEGLAPGQRVAADACQHCGECADCREGRYNLCER
LAFTGLMNDGAFAEFVNVPANIVYALPEGFPTEAGALIEPLAVGMHAVRKAGRVAGRSVV
VVGAGTIGLCTLMCARAEGAARIIVLEMSAARKAKAREVGADVVLDPSECDAIAEIQALT
GGRGAELAFECIGHKDTAKLAIDTVRKAGRVVMVGIFEEPSAYNFFELVASEKEVVGSLA
YSGEFADVIRLIDQGVLDIEPLITGRITLPEIIDKGFEELVHRKDQNVKIIVQPAA
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgatgcaagcggcggtctggcacggccgccaggacgtgcgcctcgagacggtg
ccgcgtcccgcggccccggcggcgggctgggtccaggtgcgggtccactggtgcgggatc
tgcggctccgacctccacgagtacctggccgggccggtgttcatcccggtcgacgcgccg
catccgctcaccggcgcccagggccggtgcatcctcggccacgagttctgcggcgagatc
gtcgcggtgggcgagggcgtggaagggctggcgcccggccagcgggtggccgccgatgcc
tgccagcactgcggcgagtgcgccgactgccgggagggccgctacaacctctgcgagcgg
ctggccttcaccgggctgatgaacgacggcgccttcgccgagttcgtcaacgtgcccgcc
aacatcgtctatgcgctgcccgaggggttccccaccgaggccggggcgctgatcgagccg
ctggcggtgggcatgcatgccgtgcgcaaggcaggtcgagtggcggggcgcagcgtggtg
gtggtcggggccgggaccatcggcctgtgcaccctgatgtgcgcccgggccgagggcgcg
gcgcggatcatcgtcctggagatgtccgccgcccggaaggccaaggcccgagaggtgggc
gccgacgtggtgctcgaccccagcgagtgtgatgccatcgccgagatccaggcgctcacc
gggggacggggcgccgagctggccttcgagtgcatcggccacaaggacaccgccaagctc
gccatcgataccgtccgcaaggccgggcgggtggtgatggtgggcatcttcgaggagccc
agcgcctacaacttcttcgagctggtggccagcgagaaggaggtggtcggctcgctggcc
tacagcggcgagttcgccgacgtcatccgcctgatcgaccagggcgtgctggacatcgag
ccgctgatcaccgggcgcatcaccctgcccgagatcatcgacaagggcttcgaggaactg
gtccaccgcaaggaccagaacgtcaagatcatcgtgcagcccgccgcctga

DBGET integrated database retrieval system