KEGG   Halomonas beimenensis: BEI_2988Help
Entry
BEI_2988          CDS       T05125                                 

Gene name
adhP2
Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
hbe  Halomonas beimenensis
Pathway
hbe00010  Glycolysis / Gluconeogenesis
hbe00071  Fatty acid degradation
hbe00350  Tyrosine metabolism
hbe00625  Chloroalkane and chloroalkene degradation
hbe00626  Naphthalene degradation
hbe01100  Metabolic pathways
hbe01110  Biosynthesis of secondary metabolites
hbe01120  Microbial metabolism in diverse environments
hbe01130  Biosynthesis of antibiotics
hbe01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:hbe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BEI_2988 (adhP2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BEI_2988 (adhP2)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    BEI_2988 (adhP2)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BEI_2988 (adhP2)
   00626 Naphthalene degradation
    BEI_2988 (adhP2)
Enzymes [BR:hbe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BEI_2988 (adhP2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C TrkA_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ATJ83975
UniProt: A0A291PAT5
LinkDB All DBs
Position
complement(3159578..3160603)
Genome map
AA seq 341 aa AA seqDB search
MDKTMQAAVVRSFGEPLTLEEVEVPRPGRGEILVRIAASGVCHTDLHAAHGDWPIKPEPP
FIPGHEGVGHVAAVGEGVTHLKEGDRVGVPWLYSACGHCEHCLGGWETLCESQQNTGYSV
NGGFADYTLADAGYVGRLPDDVDFLEIAPVLCAGVTVYKGLKMTDTRPGQWVVISGIGGL
GHMAVQYAKAMGLNVAAVDIDDAKLALAERLGATVTVNALKTDPVAYLKREIGGAHGVLV
TAVSPKAFEQAQGMVRRGGTISLNGLPPGDFPLPIFDTVLNGITVRGSIVGTRQDLQEAL
DFAGEGKVKATVHGDRLENINDVFQRMIDGRIEGRVVLDMS
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggacaagacgatgcaagccgccgtggtgcggtccttcggcgaaccgctgaccctggaa
gaggtcgaggtgccgcggcccgggcgcggcgagatcctggtcaggatcgccgcctccggc
gtctgccacaccgatctgcacgccgcccacggcgactggccgatcaagcccgagccgccc
ttcatccccggccacgagggcgtcgggcatgtggccgccgtgggggagggcgtgacccac
ctcaaggagggcgaccgggtcggcgtgccctggctgtactccgcctgcggacactgcgag
cactgcctgggcggctgggagaccctgtgcgagtcccagcagaacaccggctactcggtg
aacggcggcttcgccgactacaccctggccgatgccggctacgtgggtcgcctgcccgac
gacgtggacttcctggagatcgcgccggtgctgtgtgccggggtgaccgtctacaagggg
ctcaagatgaccgacacccggcccggccagtgggtggtgatctccggcatcggcgggctc
ggtcacatggcggtgcagtacgcgaaggccatggggctcaatgtcgccgcggtggacatc
gatgacgccaagctggcgctggccgaacgccttggcgccacggtcaccgtcaatgccctc
aagaccgacccggtcgcctacctcaagcgcgagatcggcggcgcccacggcgtgctggtc
accgcggtgtcccccaaggccttcgagcaggcccaggggatggtgcgccggggcgggacc
atctcgctcaacggcctgccgcccggggactttccgctgccgatcttcgacaccgtgctc
aacggcatcaccgtgcgaggctccatcgtcggcacccgccaggacctccaggaggccctg
gacttcgccggcgagggcaaggtcaaggccaccgtccacggcgatcgtctggagaacatc
aacgacgtcttccagcgcatgatcgacggccggatcgaggggcgggtcgtgctcgacatg
tcctga

DBGET integrated database retrieval system