KEGG   Halomonas beimenensis: BEI_3373Help
Entry
BEI_3373          CDS       T05125                                 

Gene name
gatA2
Definition
(GenBank) aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
hbe  Halomonas beimenensis
Pathway
hbe00970  Aminoacyl-tRNA biosynthesis
hbe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hbe00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BEI_3373 (gatA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hbe03029]
    BEI_3373 (gatA2)
Enzymes [BR:hbe01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BEI_3373 (gatA2)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BEI_3373 (gatA2)
Mitochondrial biogenesis [BR:hbe03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BEI_3373 (gatA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ATJ84360
UniProt: A0A291PBU5
LinkDB All DBs
Position
3588538..3589968
Genome map
AA seq 476 aa AA seqDB search
MSSPRPYESLISLSATEALKRFRRGALSPLALVEDCLARIERENPAINAFAHLSPDAARA
EARASEARWKAGTPRGPLDGLPVTLKDMTRTADMPTRLGSRTTPAEGLGEQDAPVAAHLR
EAGAVILGKTTTPEYGWKAVTDSPLTGVTRNPWNPRLTPGGSSGGAAAAAALNLGLLHQG
SDAGGSIRIPAAFTGTVGIKPSFGWVPQWPASPMGTLSHLGPIARRVEDAVLMLEAMARP
DARDGHLGNPRRPDWRTPPPPDLRGWRIALSLDLGYVEVAPDIAARVREAATRLRELGAR
VEEAAPGIACPLATFNTLWFAGASQLLDAWSEAQRRRLDPGLLDIARRGATLPLRDYLAA
CRARERLTAQLADFHRRFDLLVTPTLPLSPFAAGHDVPPDGPYQEWMEWTPFTYPFNLSQ
QPALSMPCGLDDRGLPVGLQLVGARFDDLRVLHAARLLEPRLPRSFPETACRAGNE
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtcatccccccggccatacgagagcctgatctccctgtccgcgaccgaggccctcaag
cggttccgccgcggcgccctctcgccgctggcgctggtcgaggactgcctggcccgcatc
gagcgcgagaaccccgcgatcaacgccttcgcccacctgtcgccggacgccgcacgggcc
gaggcccgggcgtcggaggcgcgctggaaggccggcacgccccgcggtcccctggatggc
ctcccggtcaccctcaaggacatgacccgcaccgccgacatgccgacccggctgggctcg
cgaaccacgccggccgagggcctcggggagcaggacgcccccgtcgccgcccacctgcgc
gaggcgggggcggtgatcctcggcaagaccaccaccccggaatacggctggaaggcggtc
accgactcgccgctgaccggcgtgacccgcaacccctggaacccccgcctcacgcccggc
ggctcctcgggtggggccgccgccgccgcggcgctcaacctggggctgctgcaccagggc
agcgacgccggcggctcgattcgcatccccgccgccttcaccggcaccgtcggcatcaag
ccgagcttcggctgggtcccccagtggccggccagccccatgggcaccctgtcccacctc
ggcccgatcgcccgccgcgtcgaggacgccgtgctgatgctggaggcgatggcccggccc
gatgcccgggacggccacctgggcaatccccggcggcccgactggcggacgccgccgcct
cccgacctgcggggctggcgcattgccctgagcctcgacctgggctacgtggaggtggcc
ccggacatcgccgcccgggtgcgggaggcggcgacacggctgcgggagctcggtgcccgg
gtcgaggaagccgcccccggcatcgcctgccccctggcgaccttcaacaccctgtggttc
gccggggcctcccagctgctcgacgcctggagcgaggcccagcgccgccggctcgatccg
gggctgctggacatcgcccgtcgcggcgccaccctccccctccgcgactacctggccgcc
tgccgggcccgggagcgactgaccgcacaactcgcggacttccaccggcgcttcgacctg
ctggtcacgccgaccctgccgctgtcgcccttcgccgcgggccacgacgtgcccccggac
ggcccctaccaggagtggatggagtggacgcccttcacctatcccttcaacctcagccag
cagccggccctctcgatgccctgcggcctggacgaccggggcctgccggtgggcctgcag
ctggtcggcgcccgcttcgacgacctgagggtgcttcacgcggcccgcctgctggagccc
cgactgccacgctccttccccgagaccgcgtgccgtgccgggaatgagtaa

DBGET integrated database retrieval system