KEGG   Helicobacter bizzozeronii: HBZC1_03150Help
Entry
HBZC1_03150       CDS       T01540                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
hbi  Helicobacter bizzozeronii
Pathway
hbi00564  Glycerophospholipid metabolism
hbi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hbi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    HBZC1_03150
Enzymes [BR:hbi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     HBZC1_03150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored GIDA NAD_binding_8 HI0933_like Pyr_redox_3 Pyr_redox_2 FAD_binding_3 Lycopene_cycl Thi4
Motif
Other DBs
NCBI-ProteinID: CCB79301
UniProt: F8KRC6
LinkDB All DBs
Position
292516..294057
Genome map
AA seq 513 aa AA seqDB search
MQRTTQLQQLPDSLDVIIIGGGASGLGLALDAASRGYHTLLLEAHDFAKGTSSRSTKLLH
GGVRYLAQGDFSLVYEALHERGTLMQNAPHLCAPQGFVIPCANLSSALFYGLGLKLYALM
AGKLQLHRTDVLFKPQGILEGVKQEKCRHAVCYYDGQFDDARLALSLALSAHDHGALLLN
YAQVKSLLFENDQVCGVVFEDRINQQEIRLKAHCVINATGVFTNAINHMDPSTQENHITP
SQGIHLVLDQKFLPSKHALMVPKTSDGRVLFAIPWHGKLLVGTTDTPVQEVSLEPKALPE
EIDFLLNTLGEYLEQQPTRKDVLSVFVGLRPLMASSKVRATKKLSRSHKIYIAPSGLVHL
NGGKWTTYRHMAQETLDVCIQQGLLPAKTCYTRTLKLHGYTSEDLDPRLKVYGTHAQAIL
DLENANPHLARLIHPNYPYTYAQVFWALEHEMAYRLEDVLSRRMRLLFLDARAALKCARE
VGEFMGAYFGWDISYQEQEITQFETLAKTHILE
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgaacaacacaattacaacaacttccggattccctagatgtgatcatcattggg
gggggtgctagcggactagggctggctttagatgccgctagcagagggtatcacacccta
ttattagaagcccatgattttgctaagggcacttctagtcgttccaccaagcttttacac
gggggcgtgcgttatttggcacaaggggattttagcttggtctatgaagccttacatgaa
cgggggacgctcatgcaaaatgccccccacctgtgcgccccacaaggctttgtgattcct
tgtgccaatttatccagcgcgcttttttatggcttggggctcaagctctacgccctaatg
gcgggtaaattgcaactgcaccgcaccgatgtactttttaagccccaaggaatcctagag
ggggtcaaacaagaaaaatgccgtcatgcggtgtgctactatgatgggcaatttgacgat
gcccgtttggctttgagtttggctctaagcgcacatgatcatggcgcgctgttgttaaac
tacgcccaagttaaaagcttgctttttgaaaatgaccaagtttgtggcgtggtgtttgaa
gatcgtatcaaccagcaagaaatccgccttaaagcacattgtgtgatcaatgctacgggt
gttttcaccaatgcgatcaaccacatggatcctagcacccaagaaaaccacatcacgccc
tctcagggtatccatttggttttggatcaaaaattcttgccctccaagcatgccctaatg
gtgcctaaaacctctgatgggcgtgtgttatttgccattccttggcatggtaagttgctg
gtgggcacaactgatacccccgtgcaagaggtgagcctagaacctaaagccctgcccgaa
gagattgattttttgctcaacactttgggggaatatttggaacaacaacccacccgcaaa
gatgttttgtcggtctttgtggggcttagacccttgatggcaagttctaaggtgcgcgcg
actaaaaaactctcccgtagccataaaatttacattgcacccagtgggttagtccatctt
aatgggggcaaatggaccacctacagacacatggcacaagaaaccctagatgtctgtatc
caacaagggcttttgcccgctaaaacctgttacacacgcacgctcaaattacatggctat
accagcgaggatttagacccacgcttaaaagtctatgggacgcatgcccaagcgatctta
gatttagaaaatgctaacccccatttagcccgcttgatccaccccaactacccctatacc
tatgcccaagtgttttgggcgttagaacatgagatggcttaccgcttagaggatgtgctc
tccagacgcatgcgcttgctctttttagatgcgcgtgctgccctcaagtgcgctagagaa
gtgggggaatttatgggggcgtattttggctgggatataagctatcaagaacaagaaatc
acgcagtttgaaactctggctaaaacccacatcttagaataa

DBGET integrated database retrieval system