KEGG   Helicobacter bizzozeronii: HBZC1_03410Help
Entry
HBZC1_03410       CDS       T01540                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
hbi  Helicobacter bizzozeronii
Pathway
hbi00473  D-Alanine metabolism
hbi00550  Peptidoglycan biosynthesis
hbi01100  Metabolic pathways
hbi01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hbi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    HBZC1_03410
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HBZC1_03410
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    HBZC1_03410
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hbi01011]
    HBZC1_03410
Enzymes [BR:hbi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     HBZC1_03410
Peptidoglycan biosynthesis and degradation proteins [BR:hbi01011]
 Precursor biosynthesis
  Amino acid ligase
   HBZC1_03410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp GARS_A ATP-grasp_4 Nudc_N DUF1205
Motif
Other DBs
NCBI-ProteinID: CCB79327
UniProt: F8KQ12
LinkDB All DBs
Position
318999..320051
Genome map
AA seq 350 aa AA seqDB search
MEYGLLFGGKSYEHEISIVSAIVLKQVLGTQIAHFIFLDGAHRFYLIAEKDMRSQFFSSG
HYKKCPELILKHQGFHTHGLLGSKPINMENLINLIHGGDGEDGKIASFLEFYGIDFIGPR
VEACVMSYNKYFTKMLAKEKGINTLPYVFLDKREGSAIKGLSYPLIIKPNRLGSSIGISI
LKDEKDIEYVLDEVFEFDSQVIIESFKEGVKEYNLAGCMVKKGGDDTESEFIFSVVEEPK
KKEFLGFEEKYLDFGRTQKVKKADISSELEMQMRALFKRIYEPLFIGAIIRCDFFVINDE
IYLNEINPIPGSLAHYLFEDFSSVLEQVVLPKEVSIPITYHYIEQIQKAK
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
gtggaatacgggttgttatttggcggcaaaagctacgaacatgaaattagtattgtgagt
gccattgttctcaaacaagttttaggcacacagatcgcacattttatctttttagatggc
gcacaccgcttttatttgatcgctgaaaaagacatgcgttcgcagtttttttccagcggg
cattataaaaaatgccccgagctcattttaaaacatcagggcttccacacgcatggctta
ctggggagcaagccaatcaatatggaaaatctcattaatctaatccatgggggcgatggc
gaagatggcaaaatcgcctcctttttagagttttatggcatcgattttattggccctcgg
gtggaagcttgcgtgatgagttataacaagtattttaccaaaatgcttgccaaagaaaag
gggatcaacactctgccctatgtgtttttagacaaacgcgaaggcagcgcgatcaaaggg
ctttcctaccccctaatcatcaaacccaaccgcttggggagctccattgggatcagcatt
ttaaaagatgaaaaagatattgagtatgtattagatgaagtctttgaatttgacagccaa
gtcattatcgagtcttttaaagagggcgtgaaagaatacaacttggctgggtgcatggtg
aaaaaggggggcgatgataccgagagtgaatttatcttttctgtggtcgaagagcctaag
aaaaaggagtttttggggtttgaggagaaatatttagactttgggcgcacccaaaaggtc
aaaaaggcagacatcagcagcgagttagaaatgcagatgcgcgcccttttcaaacgcatt
tacgagcccctatttattggggcaattatccgttgtgatttttttgtcatcaatgatgaa
atttacttaaatgagatcaaccccattcccgggagtctcgcccattatctttttgaagac
ttttctagtgtcctagaacaagtggttttacccaaagaagtgtctatccccatcacttat
cattacatcgaacaaatccaaaaagccaagtga

DBGET integrated database retrieval system