KEGG   Helicobacter bilis: XJ32_00615Help
Entry
XJ32_00615        CDS       T04788                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
hbl  Helicobacter bilis
Pathway
hbl00620  Pyruvate metabolism
hbl00680  Methane metabolism
hbl01100  Metabolic pathways
hbl01120  Microbial metabolism in diverse environments
hbl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hbl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    XJ32_00615
  09102 Energy metabolism
   00680 Methane metabolism
    XJ32_00615
Enzymes [BR:hbl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     XJ32_00615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 Baculo_LEF5 PP1
Motif
Other DBs
NCBI-ProteinID: AQQ58839
UniProt: A0A1Q2LEK0
LinkDB All DBs
Position
139669..142464
Genome map
AA seq 931 aa AA seqDB search
MQQELCKYEFLKTILLEVIEENSPEVKETFLMLFNSLRDKNTDSTKIKDLFHEISESQHL
MGVIKACSLHNIILNIYEEQEQAKIASVSRSIATAYKNLEEEGFDRIDCDRVLESIRFYP
VFTAHPTESRRRTFLEAHQEITRELEKIEQFSYMPSEQIPYKDREIAQSRESIKYRLHLL
WKSHLVRSEKLEVIFELDNLLFIIENSILPSALRVLNQVSNRLNKPLKISPIKLGSWIGG
DRDGNPFVSNEMMTRVMKMQHELIIQTYIKEINKLIRELSLSVDFCTPSKELQKSLQKEK
SYLNQTSLKLHEREPFRAKLNLIKLKLQNHLLKVNAVGEVDFTYQNPKELLEDIDMLIAS
LDSIAAKRLKSLRNLVLLGGFHLMQLDFREHRDMYMNAVSEVLCLLGYTDSDFIHRHESK
KIEILNKVLSEPPLNLNSILWEVSSQTRHTLNAFLRILWAKKAISKDILKSVIVSMTTTA
SDLLAVLYLAYCSGLWQKGKVKTTDNGECIIKDGKSGIFITPLFETIEDLENAQEILEVL
SKNEHYRQYLKDSGNAQQIMIGYSDSSKDGGIFTSNYSLYKAISNLVKLEQRLGIHFMLF
HGKGGSISRGGGQLESALLAFPRGSIGTTLKTTEQGEIISSRYLNPRVAIRSFALTLASL
LKKAVHDNFCANLNPNSNGGVQNTKNLDSVLVDKNIQIKCDVDPYLPKLEELSRISYRTY
RDLVYETPNFVSYFKQATPIEFIQNLNLGSRPSKRKDTQRVEDLRAIPWVFAWTQNRSII
PAWYGLGSALKGIGDKQLLQDCYKDSVFFKTTIDNIVQGFIKVDMEIAEMYNDFVQDFGL
KQSIWSKIHNEYNETLEWLLITRNENELLDSNKEVRETILTRMPNIKALSLLQIELVRKY
KQAQYEDLRHRLMEQIHGTIIGIAQGIRNTG
NT seq 2796 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaagaattatgcaaatatgaatttttaaaaacaattctgcttgaagtcattgaa
gaaaatagcccagaagtcaaagaaacatttctcatgcttttcaattctctaagagataaa
aatacagattccacaaagattaaagatcttttccatgaaataagtgagagtcagcattta
atgggcgttatcaaagcatgttctctgcataatatcatcttaaatatctatgaagagcaa
gaacaagcaaaaatcgcaagtgtatcaagaagcattgctactgcgtataagaatcttgaa
gaagaaggctttgatagaattgattgcgatagagtattagaatctattagattctatcct
gtatttaccgcacacccaacagaatctcgccgccgcacattccttgaagcccatcaagag
attacaagagagctggaaaaaatagagcagttctcatatatgccaagtgagcaaatcccc
tacaaagatagggagatagcccaaagtagagaaagtattaagtataggttacaccttttg
tggaaaagccatttggtgcgtagtgaaaagcttgaagtaatttttgagcttgataatctt
ttatttatcattgaaaatagcattttacctagtgccttaagggtgctaaatcaagtctca
aataggctaaataagccgctaaaaatatcccccataaagcttggtagctggataggtggc
gatagagatggcaatccttttgtaagtaatgagatgatgacacgcgttatgaaaatgcaa
catgaattaatcatacaaacctatataaaagagattaataaactcataagagagctatca
ttatctgttgatttttgcactccaagtaaagaattacaaaaatcgttacaaaaagaaaag
agctatctcaatcaaacatcattaaagcttcatgaaagagagccattccgcgcaaagctt
aatctcattaaattgaagttacagaatcatttattaaaagtcaatgcagtaggcgaagta
gattttacctatcaaaatccaaaagaacttttagaagatattgatatgcttattgcttca
ctggattctattgctgcaaagcgactaaagagtttaagaaatcttgtattgcttggtggt
ttccatctcatgcagcttgactttagagagcatagggatatgtatatgaatgcagtttct
gaagtcctatgtcttcttggctatactgatagtgattttatacacagacatgagtcaaaa
aaaattgagattctcaataaagtcttaagtgagccgccgctaaatctaaatagcatttta
tgggaagtaagctctcaaactcgccatacactcaatgcgtttttaagaatcttatgggcg
aaaaaggcaatcagcaaggatattttaaaaagtgtgattgtatccatgacaacaaccgct
agtgatttacttgctgtgctatatcttgcatactgcagtggattatggcaaaaaggcaag
gtaaaaacaactgataatggtgaatgtatcataaaagatggcaagtctggaatctttatc
acaccgctatttgagaccatagaagacttagaaaacgcacaagagattctagaagtgcta
agtaaaaacgagcattacagacaatatctaaaagattctggcaacgcacaacagattatg
ataggctactctgattctagtaaagatggtggaatctttacttctaattattctctttat
aaagcgatttcaaaccttgtgaaattagaacaaagactaggcattcacttcatgcttttc
catggcaaaggtggtagcattagtcgtggtggcggacagcttgaaagcgcacttttagca
tttccacgcggtagtatcggcacaactttgaagacaacagaacaaggtgagatcatctca
tctcgctatcttaatccacgcgtagctattagaagctttgcccttactctagcaagtctt
ttgaaaaaagcggtgcatgataacttttgtgcgaatcttaatcctaactcaaatggtggg
gtgcaaaatacaaagaatctagattctgttctcgttgataaaaatatacagattaaatgc
gatgtagatccctatctaccaaagctagaagagctttctagaatctcatatcgcacttat
agagatttagtgtatgaaacgccaaattttgtaagctattttaaacaagctacaccgata
gaatttatacagaatctaaacttaggctctcgccccagcaagagaaaagacacacagaga
gtagaagacttgcgtgctatcccttgggtatttgcatggacgcaaaatagatccattatc
ccagcatggtatggcttaggtagtgcgttaaagggaataggcgataagcagttgctgcaa
gattgctataaagattctgtattttttaaaactacgattgataatatcgtgcaaggcttc
attaaagttgatatggagatagcagaaatgtataatgactttgtgcaagactttggatta
aagcaaagtatttggagtaaaatccataatgaatataatgaaacacttgagtggctactc
atcacgcgtaatgaaaacgagcttttagatagcaataaggaagtaagagagactatcctt
acgcgtatgccaaatattaaagctttaagccttttgcaaatcgagcttgtaaggaaatat
aaacaagcccaatatgaagacctgcgtcatcgccttatggaacaaatccatggcacaatc
attggtatcgcacaaggtattagaaacacggggtga

DBGET integrated database retrieval system