KEGG   Helicobacter bilis: XJ32_04835Help
Entry
XJ32_04835        CDS       T04788                                 

Definition
(GenBank) tRNA-processing ribonuclease BN
  KO
K07058  membrane protein
Organism
hbl  Helicobacter bilis
Brite
KEGG Orthology (KO) [BR:hbl00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    XJ32_04835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB
Motif
Other DBs
NCBI-ProteinID: AQQ60668
UniProt: A0A1Q2LJM8
LinkDB All DBs
Position
1027392..1028231
Genome map
AA seq 279 aa AA seqDB search
MQKLQHFYANITKHRYFISEKISYCWHAVTDNDRIFHYAASLSFYSIFSIIPAFLMFFSL
FSLFPSFQDQLQILKQSILDNILPDNAHEFAKILDNFLSNGKEMGFVGFLISLISSFIFF
RNFDDVAARIFEAKKRGYFDSFIIYWLLVTLIPMFLATSIYFNAVIVDIYSDAVITKYYS
FIPMLATWIAFAMLFRVAANKPLRFFVLILASLLGAIVWYGLKIIFFYYMSYNKFYSNIY
GSVSIIMFAFLWIYVSWLVVLFSMQFCKWLDTKYPCSES
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
ttgcaaaaactacaacatttttatgcaaacataaccaagcatcgctattttatcagtgaa
aaaatctcatattgttggcatgctgtaaccgataatgatagaatctttcattatgcggct
tctttaagtttttatagcattttttctattattcctgcttttttaatgtttttttctctt
ttttcactttttccaagctttcaagatcaattacagattctaaaacaatctatccttgat
aatattttgcctgataatgcccatgagtttgcaaaaatcctagataattttttatcaaat
ggcaaagagatgggctttgtaggctttctcatctcgcttattagctcttttatattcttt
aggaattttgatgatgttgctgcacgcatttttgaggcaaaaaaacgcggttattttgac
tcttttatcatatactggcttttagttacgcttatacccatgtttcttgctacttcgatt
tactttaacgcagtgattgtggatatatactctgatgctgtgattacaaaatattattct
tttatacctatgcttgctacttggattgcatttgctatgctttttcgtgtagcagcgaat
aagccattgcgattttttgtgttgatactagcgagtttgcttggtgcaattgtgtggtat
ggtttaaaaatcatatttttttactacatgagttataataagttttatagcaatatctat
ggctcagtctcaattattatgtttgcatttttatggatttatgtatcatggcttgttgtg
cttttttctatgcagttttgtaaatggctcgatacaaaatatccatgtagtgaaagctag

DBGET integrated database retrieval system