KEGG   Halogeometricum borinquense: Hbor_16840Help
Entry
Hbor_16840        CDS       T01359                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
hbo  Halogeometricum borinquense
Pathway
hbo00564  Glycerophospholipid metabolism
hbo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hbo00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Hbor_16840
Enzymes [BR:hbo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Hbor_16840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO FAD_binding_2 Pyr_redox_2 FAD_binding_3 Pyr_redox NAD_binding_7 Thi4 3HCDH_N FAD_oxidored ApbA NAD_binding_8 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: ADQ67252
UniProt: E4NLP9
LinkDB All DBs
Position
1613197..1614420
Genome map
AA seq 407 aa AA seqDB search
MADDTDVVVIGGGATGAGIVRDLALRGVDVTLVERGGLSAGTSGRSHGLLHSGARYAEAD
EVGARECIAENRILRDIAGECVRDTGGLFLQLAEDDPEYFEAKRTACEDIGIPIETLSGD
EVRNEISGLSEAVERAMKVPDAVVSPSRLVAANAADARDHGATILTNAPVEDLHVEDGRI
TGVKVGGSVGETIAAKQVVNAAGAWAEDVGRMAGVEVAMRPTKGVMVSVQYDGLGPVLNR
ARDPADGDIVVPHDGEVVLGTTSIEVDDPDDYPEDAQEVERMVEECSKMLPPAREAERVR
TWWGVRPLYAPDEDSREGARGISRGFFCVDHGDDGVENFTSIVGGKLTTYRQMAEATTDR
VCEKLGVAADCRTAAKRLPGADDPEQLDAYVTEFGGAGPTDEDVVRG
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgacaccgacgtagtggtgattggcggcggtgcgactggtgctggaatcgtc
cgcgatttggcgttgcgcggcgtggacgtgacacttgtcgaacgtggtggcctttcggcg
ggaacctccggtcggtctcatggcttgcttcacagcggtgcgcgatacgccgaggccgac
gaggtgggtgcgcgcgagtgtatcgcggaaaatcgaatcctgcgcgatattgctggcgag
tgcgttcgcgataccggtggcctgttcctccaactggccgaggacgaccccgagtacttc
gaggcaaagcgcaccgcctgcgaggatatcggcatcccgatcgagacgctctctggcgac
gaggtgcggaatgaaatatcgggcctctccgaggctgtcgagcgcgcgatgaaagttccc
gacgccgtcgtctccccgtcgcgcctcgtcgccgcgaacgccgcggacgcccgcgatcac
ggagcgactatcctgacgaatgcacccgtggaagacctgcacgtcgaagacggccgcatc
accggcgtcaaagtcggcggatcggtcggtgagaccattgccgcgaaacaggtcgtcaac
gccgctggcgcgtgggcagaagacgtcggccggatggcgggcgtcgaggtggcgatgcgt
cccacgaagggagtgatggtctcagttcagtacgacggactcggtcccgttctcaaccgc
gcccgcgaccctgcggacggcgacattgtcgtcccgcacgatggggaagtcgtcttggga
acgacgagtatcgaggtggacgaccccgacgactatccggaggatgcccaagaagtcgaa
cggatggtcgaagaatgctcgaagatgcttccgcctgcccgcgaggctgaacgggttcga
acgtggtggggcgtccgcccactctacgcaccggacgaggattcccgcgagggtgcgcgc
ggtatctctcgcggcttcttctgcgtggatcacggcgacgacggcgtcgaaaacttcacg
agtatcgtcggcgggaaactcaccacctatcgacagatggccgaggccacgacggaccgc
gtctgcgagaaactcggtgttgctgccgactgtcgaaccgcagcaaagcgacttccgggc
gcagatgaccctgaacagttagacgcatacgttacggagttcggcggtgcaggaccgacg
gacgaagacgtggttcgaggctga

DBGET integrated database retrieval system