KEGG   Halogeometricum borinquense: Hbor_27460Help
Entry
Hbor_27460        CDS       T01359                                 

Definition
(GenBank) prephenate dehydratase
  KO
K04518  prephenate dehydratase [EC:4.2.1.51]
Organism
hbo  Halogeometricum borinquense
Pathway
hbo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hbo01100  Metabolic pathways
hbo01110  Biosynthesis of secondary metabolites
hbo01130  Biosynthesis of antibiotics
hbo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hbo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Hbor_27460
Enzymes [BR:hbo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     Hbor_27460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDT ACT TIP39
Motif
Other DBs
NCBI-ProteinID: ADQ68290
UniProt: E4NTY5
LinkDB All DBs
Position
complement(2623161..2623967)
Genome map
AA seq 268 aa AA seqDB search
MQAVTLGPAGTYSHRAARAVADDVAFRESVSAIVDAVDSGEYDRGVVPIENSIEGSVTET
LDAIAEADIAVTQEIVTPIRHALLAQTEEFSVVASHSQALAQCRSYLETEYPGVTLEAVA
STARGVERAREDDSVAGIGHPDNAGDDLRVLAEDIQDRSSNATRFFVVAPAAERSDAGGK
STVVVYPNANYPGLLLELLEAFAERDINLSRIESRPSGNRLGDYLFHIDFEAGLYEDRAQ
KALESVEEIASRGWVKRLGSYDTQHVLY
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcagttaccttgggtccagccgggacgtactcccaccgcgcggcccgcgccgtc
gccgacgacgtcgcgttccgcgaatcggtgtctgccatcgtggacgccgtcgattcgggc
gagtacgaccgcggtgtcgtccccatcgagaacagcatcgaaggaagcgtcacggagacg
ctggacgccatcgccgaggcggacatcgccgtcacgcaggagattgtgaccccgattcgg
cacgcactcctcgcccaaaccgaggagttctctgtcgtcgcctcccattcgcaggcactc
gcacagtgccggagttacttggagacggagtatcccggcgtgacgctggaggccgtcgcc
agcaccgcacgcggcgtcgaacgcgcccgcgaggacgactccgtcgcgggcatcggccat
ccggataacgccggtgacgacctccgcgtcctcgctgaggatattcaagaccgctcttcg
aacgcgacgcgctttttcgtcgtcgctcccgccgccgagcgttcggatgcgggcggtaag
tccactgtcgtcgtctaccccaacgcaaactatccggggctgcttctcgaactcctcgaa
gcgttcgccgaacgcgacatcaacctctcgcgcatcgagtcgcgtccgagcgggaaccgc
ttgggcgactacctgttccacatcgacttcgaggccggtctgtacgaggaccgcgcgcag
aaggcgctcgaaagcgtggaagaaatcgcttcccgcgggtgggtcaaacgcctcggatcg
tacgacacccagcacgtcctttactga

DBGET integrated database retrieval system