KEGG   Halogeometricum borinquense: Hbor_33470Help
Entry
Hbor_33470        CDS       T01359                                 

Definition
(GenBank) theronine dehydrogenase-like Zn-dependent dehydrogenase
Organism
hbo  Halogeometricum borinquense
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ApbA
Motif
Other DBs
NCBI-ProteinID: ADQ68871
UniProt: E4NVI7
LinkDB All DBs
Position
pHBOR02:complement(67161..68231)
Genome map
AA seq 356 aa AA seqDB search
MPLGDTLITRMLDNQNAMQAVVIDGEGSIWDEDRPRPEPEPGEALVRVSAVGICGSDIGL
MEGEGPPWTDYPLVPGHEVCAEVVELGEGVEDLNVGDRVALHGFVYCGTCTACREGRYYQ
CDDLKEVGFTIDGGYREYAALPAYTLTPIPDDVSDLEATQIDSAGCTLHGLQRVSTSFDD
TGVVLGPGSLGLYGVQLLRAQGVKDVILTGTREERLEIGEHHGASLTINVREEDPVERIL
EYTDGKGADICVEAAGAGDVVNTCLKATRKRGNVVLTGVFGGMKEIDPNDIVSKELQVVG
GVTASHTVDQVIDLFRRGDLSIDGIVTHEFDLAEYETAIETVRERRDGVVKAVLRP
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgccactcggcgacacgcttattactcggatgttagataaccaaaacgctatgcaagca
gtcgtcatcgacggagaagggagtatctgggatgaggatcgacctcgtcccgaaccggaa
ccgggcgaagcgctcgtccgcgtctccgcagtcggtatctgtggtagcgacatcggactg
atggagggtgagggtccaccgtggactgactacccgctcgttcccggccacgaggtgtgc
gccgaagtggtcgaactgggtgagggcgtcgaagacctgaacgtcggcgacagagtggct
cttcacggattcgtctattgcggcacctgtacggcctgtcgggagggccggtactaccag
tgcgatgacctgaaagaggtcggtttcactatcgacggcggctaccgcgagtacgccgcg
ctcccggcctacacgctcacgccgattcccgacgacgtgtcggatctcgaagcgacccaa
atcgactcggcgggatgtacgcttcacgggcttcaacgcgtctctacctcgttcgacgat
accggtgtcgttctcggaccgggttcgctcggtctctacggcgtccaactcctgcgcgcg
cagggcgtcaaagacgtgattctcactggaacccgcgaggaacgcctcgaaatcggtgaa
catcacggcgcgtcgttgactatcaacgtccgcgaggaggacccggtcgagcgcatcttg
gagtacaccgacggcaaaggtgcggacatctgcgtcgaagcggcgggtgcaggagacgtg
gtgaacacgtgtctgaaggcgacgagaaagcgcggaaacgtcgtccttacgggcgtcttc
ggcggtatgaaggagatcgaccccaacgacattgtctcgaaggagttgcaagtcgtcggc
ggcgtcaccgcctctcatacggttgaccaagttatcgatctgttccgccgcggtgacctg
tctatcgacggtatcgtcacccacgagttcgacctcgcggagtacgaaacggccatcgag
acggtccgtgaacgccgcgacggcgtggtcaaagccgtccttcgaccgtaa

DBGET integrated database retrieval system