KEGG   Hevea brasiliensis (rubber tree): 10351912Help
Entry
10351912          CDS       T05150                                 

Gene name
rbcL, HebrCp049
Definition
(RefSeq) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
hbr  Hevea brasiliensis (rubber tree)
Pathway
hbr00630  Glyoxylate and dicarboxylate metabolism
hbr00710  Carbon fixation in photosynthetic organisms
hbr01100  Metabolic pathways
hbr01200  Carbon metabolism
Module
hbr_M00165  Reductive pentose phosphate cycle (Calvin cycle)
hbr_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
hbr_M00532  Photorespiration
hbr_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:hbr00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    10351912 (rbcL)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    10351912 (rbcL)
Enzymes [BR:hbr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     10351912 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-GeneID: 10351912
NCBI-ProteinID: YP_004327670
UniProt: F2X0C4
LinkDB All DBs
Position
CP
AA seq 475 aa AA seqDB search
MSPQTETKASVGFKAGVKDYKLTYYTPEYQTKDTDILAAFRVTPQPGVPPEEAGAAVAAE
SSTGTWTTVWTDGLTSLDRYKGRCYGIEPVPGEENQYIAYVAYPLDLFEEGSVTNMFTSI
VGNVFGFKALRALRLEDLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGL
SAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEAIYKAQAETGEIKGHYL
NATAGTCEEMIKRAVFARELGVPIVMHDYLTGGFTANTSLAHYCRDNGLLLHIHRAMHAV
IDRQKNHGMHFRVLAKALRLSGGDHIHAGTVVGKLEGERDITLGFVDLLRDDFIEKDRSR
GIYFTQDWVSLPGVIPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHPWGNAPGAVAN
RVALEACVQARNEGRDLAREGNDIIREASKWSPELAAACEVWKEIKFEFEAVDTL
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccacaaacagagactaaagcaagtgttggattcaaggctggtgttaaagattat
aaattgacttattatactcctgagtatcaaaccaaagatactgatatcttggcagcattc
cgagtaactcctcaacctggagttccgcctgaggaagcaggagctgcggtagctgctgaa
tcttctactggtacatggacaactgtgtggaccgatggacttaccagtcttgatcgttat
aaaggacgatgctacggcatcgagcctgttcctggggaagaaaatcaatatattgcttat
gtagcttacccattagacctttttgaagaaggttctgttactaacatgtttacttccatt
gtgggtaatgtatttgggttcaaagccctacgcgccctacgtctggaggatttgcgaatc
cctcctgcttattctaaaactttccaagggccgcctcatggcatccaagttgagagagat
aaattgaacaagtatggtcgccccctattgggttgtactattaaaccaaaattgggtcta
tccgctaagaattacggtagagcagtttatgaatgtcttcgcggtggacttgattttacc
aaagacgatgagaatgtgaactcccaaccatttatgcgttggagagaccgtttcttattt
tgtgccgaagcaatttataaagcacaggctgaaacaggtgaaatcaaaggacattatttg
aatgctactgcaggtacatgcgaagaaatgatcaaaagggctgtatttgccagagaatta
ggagttcctatcgtaatgcatgactacttaacagggggattcactgcaaatactagcttg
gctcattattgccgagataatggtttacttcttcacattcaccgcgcaatgcatgcagtt
attgatagacagaagaatcatggtatgcattttcgtgtactagctaaggccttacgtcta
tctggtggagatcatattcacgccggtaccgtagtaggtaaacttgaaggggaaagagac
attactttgggctttgttgatttactgcgtgatgattttattgaaaaagatcgaagccgt
ggtatttatttcactcaagattgggtctctctaccaggtgttatacctgtagcttcaggg
ggtattcacgtttggcatatgcctgctctgaccgagatctttggagatgattccgtacta
caattcggtggaggaactttagggcacccttggggaaatgcacccggtgccgtagctaat
cgagtagctctagaagcatgtgtacaagctcgtaatgagggacgtgatcttgctcgtgag
ggtaatgatattatccgtgaggctagcaaatggagtcctgaactagctgctgcttgtgaa
gtatggaaggaaattaaatttgaatttgaagcagtggatactttgtaa

DBGET integrated database retrieval system