KEGG   Hevea brasiliensis (rubber tree): 110634595Help
Entry
110634595         CDS       T05150                                 

Definition
(RefSeq) histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH3-like
  KO
K11420  euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
hbr  Hevea brasiliensis (rubber tree)
Pathway
hbr00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:hbr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    110634595
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hbr03036]
    110634595
Enzymes [BR:hbr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     110634595
Chromosome and associated proteins [BR:hbr03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     110634595
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SAD_SRA SET Pre-SET
Motif
Other DBs
NCBI-GeneID: 110634595
NCBI-ProteinID: XP_021639357
LinkDB All DBs
Position
Unknown
AA seq 673 aa AA seqDB search
MEGGSGSNSVPPSATFDKSRVLDVKPLRSLVPVFPSSPQAPPFVCAPPSGPFPSGFSPFY
PFNGPQPTPPDLNQHTHTPAPLRSFRAPQSNGKMATDGNADGSTGAPTKRPVGRPRSSSA
SQKKAKKDLVFTLAVVDNNFVLGITPAQREDGDTEVVNNVRMRFDALRRRLSQLEDAKES
PNGWIRRADLKAANIMMSKGLRTNLRKRVGVVPGVEVGDIFFFRMEMCLVGLHSQTMAGI
DYMIVRADIEEDPLAVSIVSSGGYEDEAEDRDVLIYSGQGGNVNSNKKEAADQKLERGNL
ALERSLHRNNEVRVIRGMKDAISPTAKVYVYDGLYRIQESWVEKGKSGCNIFKYKLVRLP
GQPGAFDVWKSIQQWREGFSSRIGLILPDLTSGTEGIPVSLVNDVDEEKGPAYFTYFASV
KYVKSFKLTEPSCGCNCHNACAPGDLNCSCIRKNGGDFPYTANGVLVSRRPLVHECGPTC
PCIPNCKNRVTQTGLKVRLEVFKTKDRGWGLRSWDPIRAGTFICEYAGEVIEKVKARQDG
EGEDDDYVFDTTRVYEPFKWNCEPGLVEGDGNDTTEEYSIPSPLIISAKNVGNVARFMNH
SCNPNVFWQPVAYEQNSESYFHIAFFAMKHIPPMTELTYDYGTSRSDEADGNDSLHGKKK
CLCGSPRCRGCFG
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atggaaggagggtctggtagcaattctgtacctccttcggctacgtttgacaaatcaaga
gtgttggatgtcaaaccgctgcgtagtttggttcctgtgtttccatctagtcctcaggct
cctccttttgtttgtgcgcctccttctggtcctttcccgtctggtttttccccgttttac
ccttttaatggaccgcaacccactcctcctgacctcaaccagcatacccacactccagcg
cctcttcgatctttccgggcgccacagtcaaatgggaagatggctacagatgggaacgca
gatggttccacaggtgccccaacaaagcgtcctgtggggcggccaagatcctcctccgca
tcccaaaagaaggccaagaaagacctggtttttaccttggctgttgttgataataacttc
gttttggggattactcccgctcagagggaggatggtgacacggaagtggtgaataacgtg
cgaatgaggtttgatgcccttaggagaaggcttagccaattagaggatgctaaggaatcg
cccaatgggtggattaggcgtgcagatttgaaagcagccaatattatgatgagcaaaggg
ttgaggacgaatctgaggaagagagttggagtggttcctggagttgaggttggggatatt
ttctttttccgaatggagatgtgtttagttgggttgcattcccagaccatggctgggatt
gattacatgattgtgagagctgatatagaagaagatccactggctgtaagcattgtttct
tctggtgggtatgaggatgaggcagaggatagggatgttttaatttatagtgggcagggt
ggtaatgtcaacagcaacaagaaggaagcagctgatcagaaacttgagaggggtaacctt
gcattggagaggagcttgcatcgtaacaatgaggtgagagtcattcggggtatgaaggat
gccattagtccaacagcaaaggtctatgtgtatgatgggctttataggatccaggagtca
tgggtggaaaaggggaaatctggttgcaatatatttaagtacaagttggttaggttgcct
gggcagccaggtgcttttgatgtttggaaatcaatacagcagtggcgggaagggttttct
tcaaggattggtttaattctgccagacctcacttcggggactgaaggtatccctgtgtca
cttgtaaatgatgttgatgaagagaagggacctgcatacttcacatactttgctagtgtc
aagtatgttaaatcatttaagttaacagagccttcttgtggatgcaactgccataatgca
tgtgccccaggtgatctgaactgctcttgcattaggaaaaatggaggtgacttcccctat
actgccaatggggttctagttagccggaggccgttggttcatgaatgtggtcccacatgt
ccatgcattcccaactgtaagaaccgggtgacacaaactggtttaaaggttcgcttggaa
gtgtttaaaaccaaggacagaggttggggcctgcggtcatgggatcctattcgtgctggt
acttttatttgtgaatatgcgggtgaagttatagaaaaagtaaaggcaaggcaggatgga
gaaggtgaagatgatgattatgtgtttgatacaacacgtgtttatgagccattcaaatgg
aattgtgaacctggactagtggagggggatggtaatgacaccactgaggaatacagcatc
ccttctcctctaatcataagtgccaagaatgttggaaatgtagctcgatttatgaatcat
agttgtaatccaaatgttttttggcaaccagttgcgtatgaacaaaatagtgagtcctac
ttccatattgcattttttgcaatgaaacacatcccccctatgacagagttgacttatgac
tatgggacttcccgctcggatgaggctgatggtaatgattcattgcatggaaaaaagaaa
tgcctgtgtggatcgccaagatgccgaggttgttttggttga

DBGET integrated database retrieval system