KEGG   Hevea brasiliensis (rubber tree): 110634943Help
Entry
110634943         CDS       T05150                                 

Definition
(RefSeq) alpha-glucosidase-like
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
hbr  Hevea brasiliensis (rubber tree)
Pathway
hbr00052  Galactose metabolism
hbr00500  Starch and sucrose metabolism
hbr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    110634943
   00500 Starch and sucrose metabolism
    110634943
Enzymes [BR:hbr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     110634943
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 110634943
NCBI-ProteinID: XP_021639792
LinkDB All DBs
Position
Unknown
AA seq 903 aa AA seqDB search
MERQSHSHLLLLFLTILFPFSLGQEIGTVGYGYVIEPTTVSLTNNSLKADLRPVNKSTIY
GDDIESLNLLASYETNERLRIRITDSKAQRWEIPQELIPRNNIPSQHFKVRGSVDNSPVN
QGALLENQVLSSPTSDLIFTLYNTTPFGFSVSRKSNGDVLFDSSPDTNNSSTFLVFKDQY
IQFSSSLPQNRSSLYGLGEHTKSSFKLKANDTFTLWNLDIASSTQDVNLYGSHPFYVDVR
SASADGKVPAGTSHGVLLLNSNGMDIIYTGDRITYKAIGGIIDLYIFAGPSPDTVIQQYT
ELIGRPTPVPYWSFGFHQCRYGYKNVSDLEGVVAGYANASIPLEVMWTDIDYMDAYKIFT
LDPINFPADRLKNFVDKLHQNGQKYIVIVDPGISVNDSYGTFKRGLQADVFIKREGVPYL
GQVWPGPVYFPDFLNPNTTTFWRDEIKQFRDIVPVDGLWLDMNEISNFITSPLLSYSTFE
NPPYWIKNAGKGNEILINFKTVPASSMHFGDIPEYNAHNLYGLLNAKAIHETLKNLTGKR
PFVLSRSTFVSSGKYTAHWTGDIASSWVDLANTIPAILNFGLFGIPIVGADICGFIGNTN
EELCQRWIQLGAFYPFARDHSDKNSIRQELYLWDSVAATARKVLGLRYRLLPYFYTLLYE
AHTKGTPIARPLFFSFPEDINTYEINSQFLIGSGVLVSPVLNSGTFSVDAYFPEGNWFSL
FNYSDSISVSPGKYITLDTPLDHINVHVKEGNILTLQGEALTTEEARKTAFHLLVVVSSQ
QNSTGEVFLDDGESVEMGGNGGNWSLVKFNGGVVGDTAVVGSSIINGDFALSQKWIIGNV
TFIGLKNFKELKGYELHYRNETRTGNSDARASFDSNGQIAALEFLSFSLFLGDEFQLYLK
FGL
NT seq 2712 nt NT seq  +upstreamnt  +downstreamnt
atggagagacaatctcattctcatctcctacttctcttcttgaccatcttatttccattc
tcacttgggcaagaaataggaactgttggctatggctatgtaattgagcccaccaccgtt
agtttaaccaataattctttgaaagctgatcttagacccgtcaataaatctactatctat
ggggatgatattgaaagtctcaatcttttggccagctatgaaacgaatgagcgtctcaga
atcagaataacggactccaaagcacaaagatgggagatcccacaagaactcattccccgc
aataacattccctcacagcatttcaaagtaagaggttccgtcgacaattctccggtcaac
caaggagcccttctggaaaaccaagtcctctccagccccacctctgacctcattttcact
ctttataacactactcctttcggcttttccgtgtcacgcaaatccaatggcgatgtcctc
ttcgactcgtcgccggacacgaataactccagcactttcctggtcttcaaggatcagtac
atccagttctcctcctcacttccacaaaacaggtcttccctgtatggcctcggagagcac
acaaagagctcctttaagttgaaggcaaatgacactttcactttatggaatttagacatt
gcaagctcaactcaggatgtgaatctttatgggtctcacccattttacgttgacgtccga
tcagcgtcagccgatggcaaagtcccggcgggaactagtcacggtgttttattgttgaat
agcaatgggatggacataatctacaccggtgacaggataacttacaaggcgataggtggt
ataattgacttgtatatttttgctggaccatctcctgatacggttattcagcagtatacg
gaactcatcggccgtcctacgcctgtgccatactggtcttttggctttcatcagtgtcga
tatggctacaagaatgtttcggatcttgaaggcgtggttgctggctatgcaaatgctagt
atccctcttgaagttatgtggacagatattgattacatggatgcttataagattttcact
ctcgatcccattaactttcctgctgatcgtttgaaaaattttgttgataaacttcatcaa
aacggtcaaaaatacattgttattgtggatcctggcattagtgtaaatgattcctatgga
acttttaagaggggactgcaagctgatgtgttcattaaacgtgagggcgttccttacttg
ggacaagtttggccaggacctgtctacttccctgattttctgaatccaaacaccacaacc
ttctggagggacgagattaaacagtttcgagatatcgttcctgttgatggtctttggctt
gacatgaacgagatatctaatttcatcacttccccattactgtcatactccacctttgaa
aatcctccttactggattaaaaatgctggaaaaggaaatgagattttaatcaactttaag
acagtgccggcatcatctatgcattttggcgacattccagaatataatgcccataacttg
tatggactgctgaatgctaaggcaatccatgaaaccttaaaaaatttgactggcaagagg
ccatttgtgctatctagatctacttttgtaagttctggcaagtatactgctcattggact
ggagacattgcctcctcatgggttgatttggccaacaccattcctgcgatattgaatttt
ggtttatttggaataccaattgttggtgctgatatatgtggatttattggaaatacaaat
gaagaactctgtcaacgttggattcagcttggagcattttatccctttgcgagagatcac
tcagacaagaacagtattcgtcaagagctttatctctgggattcagttgctgcaacagcc
aggaaggtgctaggactccgatatcgattgcttccatacttctacacattactgtacgag
gcacacaccaaaggaacacctatagcaaggcctcttttcttctcatttcctgaagacatc
aacacttacgaaatcaattcccagtttctaattggtagtggcgtactggtctcacctgtg
ttgaattcgggaacattctcagttgatgcctacttccctgaaggaaattggtttagcctg
tttaattactccgattcaatcagtgtaagcccggggaagtatatcacacttgatacacct
cttgatcatataaatgtgcatgtcaaggaaggtaacattttgaccttgcaaggagaagct
ttgacgacagaagaagctagaaagacagcatttcacctgctagtggtggtaagcagccaa
caaaacagcactggagaagttttcttagatgatggagagagtgtggagatgggtggaaat
ggtgggaattggagcttggttaaatttaatggtggagtggttggggatacagcagtggtt
ggatcaagcatcatcaatggagattttgctttgagtcagaaatggatcattggtaatgtg
acatttataggattaaaaaactttaaggagttgaaggggtatgaattgcactacagaaat
gaaacaaggactggaaattcagatgccagagcaagcttcgatagcaatggacagattgct
gccttggagtttctaagcttttctttgtttcttggagacgaattccagttgtatcttaaa
tttggcttgtaa

DBGET integrated database retrieval system