KEGG   Hevea brasiliensis (rubber tree): 110635343Help
Entry
110635343         CDS       T05150                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B7, mitochondrial-like isoform X1
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
hbr  Hevea brasiliensis (rubber tree)
Pathway
hbr00010  Glycolysis / Gluconeogenesis
hbr00053  Ascorbate and aldarate metabolism
hbr00071  Fatty acid degradation
hbr00280  Valine, leucine and isoleucine degradation
hbr00310  Lysine degradation
hbr00330  Arginine and proline metabolism
hbr00340  Histidine metabolism
hbr00380  Tryptophan metabolism
hbr00410  beta-Alanine metabolism
hbr00561  Glycerolipid metabolism
hbr00620  Pyruvate metabolism
hbr00903  Limonene and pinene degradation
hbr01100  Metabolic pathways
hbr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110635343
   00053 Ascorbate and aldarate metabolism
    110635343
   00620 Pyruvate metabolism
    110635343
  09103 Lipid metabolism
   00071 Fatty acid degradation
    110635343
   00561 Glycerolipid metabolism
    110635343
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    110635343
   00310 Lysine degradation
    110635343
   00330 Arginine and proline metabolism
    110635343
   00340 Histidine metabolism
    110635343
   00380 Tryptophan metabolism
    110635343
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    110635343
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    110635343
Enzymes [BR:hbr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     110635343
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh AAA_25
Motif
Other DBs
NCBI-GeneID: 110635343
NCBI-ProteinID: XP_021640330
LinkDB All DBs
Position
Unknown
AA seq 541 aa AA seqDB search
MAARRISSLLSRSFTSGSVSALFSGGRNSSLGRGISRYNSTTAAATAAEGPIIPSVAVNY
TQLLINGQFVDAASGKTFPTYDPRTGEVIAHVAEGDLDDINRAVSAARKAFDEGPWPKMT
AYERSRIMLRFADLIDKHNDEIATLETWDNGKPYEQAAKIEVPMVARLFRYYAGWADKIH
GLVVPADGQHHVQTLHEPIGVAGQIIPWNFPLLMFAWKVGPALACGNTVVIKTAEQTPLT
ALYAAKLLHEAGLPEGVLNVISGFGPTAGAALASHMDVDKLAFTGSTDTGKIVLELAARS
NLKPVTLELGGKSPFIICEDADIDNAVELAHFALFFNQGQCCCAGSRTYVHERVYDEFVE
KAKARAVKRLVGDPFKGGIEQGPQVDSEQFEKILKYIRYGIQSGATLETGGDRFGTKGYY
IQPTVFSNVTDEMLIAKDEIFGPVQSILKFRDLDEVIHRANSTRYGLAAGVFTQNIDTAN
ILTRALRAGSVWINCFDIFDAAIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTPLKNPAW
L
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggctgctaggaggatatctagtttgctctctcgttccttcacttctggttctgtttct
gctctgttttcaggagggaggaattctagccttggtagaggaatcagcagatataacagt
accactgcagctgctactgctgctgagggaccaataattccttctgtagctgtgaattat
actcaacttttaattaatgggcagttcgttgatgcggcctcagggaagacttttccaaca
tatgatcctaggactggggaagtgatcgcccatgttgctgaaggtgatcttgacgatata
aatcgagcagtctctgctgctcgcaaggcatttgatgaaggaccatggccaaagatgact
gcttatgaaaggtcaaggattatgttacgctttgctgatttaattgataagcataatgat
gaaattgcaacactcgagacttgggataatgggaaaccatatgagcaggctgctaaaatc
gaagtaccaatggttgcacgtctatttcgatactatgctggttgggcggataagattcat
ggtcttgtagttccagctgatgggcagcatcatgtgcaaaccttgcatgaaccaattggt
gttgcaggtcagattattccatggaattttcctcttctcatgtttgcttggaaggtcgga
ccagcattagcgtgtggcaacactgtcgtcatcaagacagcagagcagacaccattaact
gctctctatgctgctaagctacttcatgaggctggacttccagaaggtgttctgaatgtg
atttctggctttggtccaactgctggtgcagctcttgccagccatatggatgtggataag
cttgctttcactggatcaactgatacaggaaaaattgttctggagttagcagcaagaagc
aatctcaagccagtaactttagaacttggagggaaatccccttttattatttgcgaggat
gctgatattgataatgctgttgagctggctcactttgcgttattctttaatcagggccaa
tgttgttgtgcaggctctcgcacatatgtgcatgagcgtgtttatgatgaattcgtagag
aaagcaaaggcacgtgctgtaaaacgtcttgttggtgatccattcaaagggggtattgaa
caaggcccgcaggttgattcagaacaatttgagaagatactgaagtacataagatatggt
attcaaagtggagctacacttgaaactggaggagatagatttggcaccaagggctactat
atccagcccacagttttctcaaatgtgacggatgaaatgctaatagcaaaagatgagata
ttcggtccagttcagtccatcttgaagttcagggatcttgatgaagttatacacagggca
aatagcactcgctatgggctggctgcaggggtgtttacacagaacatagacactgctaac
atcttgacccgagcattacgagcaggatcagtatggatcaattgctttgatatctttgat
gccgccattcctttcggaggatacaagatgagtggaattggaagggaaaaggggatttac
agtcttaacaattacttgcaagtgaaggctgtggttactcccttaaagaatccagcatgg
ttatag

DBGET integrated database retrieval system