KEGG   Hevea brasiliensis (rubber tree): 110636151Help
Entry
110636151         CDS       T05150                                 

Definition
(RefSeq) peroxisomal fatty acid beta-oxidation multifunctional protein AIM1-like isoform X1
  KO
K10527  enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
hbr  Hevea brasiliensis (rubber tree)
Pathway
hbr00071  Fatty acid degradation
hbr00592  alpha-Linolenic acid metabolism
hbr01100  Metabolic pathways
hbr01110  Biosynthesis of secondary metabolites
hbr01212  Fatty acid metabolism
Module
hbr_M00087  beta-Oxidation
hbr_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:hbr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    110636151
   00592 alpha-Linolenic acid metabolism
    110636151
Enzymes [BR:hbr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     110636151
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     110636151
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     110636151
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-GeneID: 110636151
NCBI-ProteinID: XP_021641403
LinkDB All DBs
Position
Unknown
AA seq 721 aa AA seqDB search
MAKPHVALEVGNDGVAVISMFNPPVNALALPIIAGLKERFDEATRRNDVQAIVLTGKNGK
FSGGFDIGVMQKVHQTGDISLVPDVSVDLVVNAIEDCKKPVVAAVDGLALGGGLELAMGC
HARIVAPKTQLGLPELTLGVIPGFGGTQRLPRLVGLSNAIEMMLLSKPITSEEGKKLGLV
DVIVSSQELLKVSRQWALDIKERCKPRMRSLHQTDKIGSLSEARELLSAARQQAKKTAPN
MPQHQACLDVIEEGVVHGGYHGVLKEAKVFKELVLSDTSKGLIHVFFSQRATSKVPSVTD
VGLKPTQIKKVAVIGGGLMGSGIATGLIMSNIYVVLKEINSDYLQKGIKMIEANVRGLVP
RGKLTQNKADKALSMLKGVLDYSEFRDVDMVIEAVVESIPLKQKIFSEIEKVCPPYCILA
TNTSTIDLNKIGEKTSAQDRIIGAHFFSPAHIMPLLEIVRTGKTSAQVILDLMTVGKSIK
KVPVVVGNCTGFAVNRTFFPYAQGAHILVNLGVDVFRIDKVISNFGLPMGPFQLQDLSGY
GVAVAVGKEFANAFPDRTFLSPLVGLLIKSGRNGKNNGKGYYIYEKGSKPKPDPSMLPII
EESRQLTNIMPNGRPINVTDQEIVEMILFPVVNEACRVLDEGVVVRASDLDIASVLGMSF
PSYRGGIVFWADMVGAKHIYKSLMKWSQLYGKFFKPSRYLEERASKGILLSAPASSTRSR
L
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagccacatgtcgccttggaggttggaaacgacggtgttgctgtcatctccatg
ttcaatcctcctgttaacgccttagctcttccaattattgcgggcttgaaggagaggttc
gatgaggccacaaggagaaacgacgttcaagctatcgttttgacaggcaagaatgggaaa
ttttccggtggatttgacattggtgtcatgcagaaggttcaccagactggggatatttcg
cttgtgcctgatgtatctgttgatcttgtggttaacgcaattgaagattgcaaaaagcct
gttgttgccgctgtggatggactagcgcttggaggtggcttagaactagcaatgggatgc
catgcacgtatagttgcacctaaaactcaacttggcttgccagaattgacacttggagta
attcctgggtttggaggtacacaacgtcttccaaggcttgtaggactgtcaaatgccatt
gaaatgatgctgttatccaaaccaatcacgtctgaagaagggaagaagcttggtcttgtt
gatgttattgtgtcttctcaagaactgctgaaagtatctcggcaatgggctttggacatc
aaagagaggtgcaaaccacggatgcgttctcttcaccagacagataagattggctcactt
tctgaagcacgcgagttattgtcagccgccagacaacaggccaagaagactgctccaaat
atgcctcagcatcaggcatgccttgatgtgatcgaggaaggtgttgttcatggaggatat
catggagttctaaaggaagcaaaagtattcaaggagttagtattatcagacacatctaaa
ggtcttattcatgtgtttttttctcagcgtgcaacatcgaaggtgcctagtgtcactgat
gttgggctcaaaccaacgcaaataaagaaggttgctgtcattggtggaggtctaatgggt
tctggcatagctacaggtcttattatgagtaacatatatgttgtactgaaagaaatcaac
tctgactatcttcagaaaggaataaagatgatagaagcaaatgttcgaggcttagtacct
aggggaaagttgacacagaataaggcagacaaagccctttcaatgcttaaaggtgtattg
gactattcagaattcagagatgttgatatggtcatagaggcagttgttgaaagcattcct
ctgaaacaaaaaatttttagtgaaattgagaaggtctgccctccttactgcatcttggca
acaaatacatctactattgacctcaataaaattggagaaaagaccagtgctcaagatcgc
attataggtgcacactttttcagtcctgctcatataatgcctcttctggagattgtacgc
acaggaaagacgtctgcacaagtaattcttgatctcatgacagttgggaaatctataaag
aaagttcctgttgtggtgggtaactgcactggctttgcagtcaaccgcactttcttcccc
tatgcacaaggtgcacatattctggtcaatttaggtgtcgacgtgttcagaattgacaaa
gtgatcagcaattttggcctacctatgggccctttccagcttcaggatttatctggatat
ggagttgctgttgcagtggggaaagaatttgctaatgcattccctgatcgcacattcttg
tctccattagttggactcttaattaaaagtggacgaaatggtaaaaacaatgggaaagga
tactacatttatgagaagggaagcaagccaaaacctgatccttccatgttaccaatcatt
gaagagtctaggcagcttaccaatattatgcctaatggaaggcccataaatgtcactgac
caagagatagtggagatgatactctttccagtagtgaatgaagcatgccgtgttctggat
gagggagtggtagttcgagcatcagatcttgacattgcatcggttttgggaatgagtttc
ccatcttatcgtggtggcattgttttctgggcagacatggttggagctaaacacatatat
aaaagcctgatgaaatggtctcaattatatggtaaattcttcaaaccatcaagatatttg
gaagaaagggcatcaaaaggcatactgttgagtgcccctgcttcatcgacaagatcacgc
ctgtag

DBGET integrated database retrieval system