KEGG   Hevea brasiliensis (rubber tree): 110636966Help
Entry
110636966         CDS       T05150                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 5 of pyruvate dehydrogenase complex, chloroplastic-like
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
hbr  Hevea brasiliensis (rubber tree)
Pathway
hbr00010  Glycolysis / Gluconeogenesis
hbr00020  Citrate cycle (TCA cycle)
hbr00620  Pyruvate metabolism
hbr01100  Metabolic pathways
hbr01110  Biosynthesis of secondary metabolites
hbr01200  Carbon metabolism
Module
hbr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110636966
   00020 Citrate cycle (TCA cycle)
    110636966
   00620 Pyruvate metabolism
    110636966
Enzymes [BR:hbr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     110636966
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-GeneID: 110636966
NCBI-ProteinID: XP_021642566
LinkDB All DBs
Position
Unknown
AA seq 469 aa AA seqDB search
MAQLLKTTFLPSSLPRASTVRSPSIHISTHRSRTTQVEAKIREIFMPALSSTMTEGKIVS
WVKSEGDKLSKGESVVVVESDKADMDVETFYDGYLAAIMVEEGGVAAVGSAIALLAETEE
EIAEARSKASSSSSSAAQPASTSSSAPEPSQTEKIAEPAGPAISKAAAIVGSAVHPASEG
GKRVVASPYAKKLAKELKVELERVVGSGPMGRIVAKDVEAAASAADAAASLAPKVGTTVN
PPSGIELGTVVPFTTMQGAVSRNMVESLAVPTFRVGYTITTDALDALYKKIKSKGVTMTA
LLAKATALALVKHPVINSSCRDGKSFTYNSSINIAVAVAMDGGLLTPVLQDADKVDIYSL
SRKWKELVDKARAKQLQPHEYNTGTFTLSNLGMFGVDRFDAILPPGTGAIMAVGASQPTV
VATKDGRIGMKNQMQVNVTADHRVIYGADLASFLQTLAKIIEDPKDLTF
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggctcagcttctcaagaccaccttccttccatcctctcttccccgggcatccactgtt
cgctctccctccatacacatttccactcaccgttccaggacaacccaggtggaggccaag
atccgagagatcttcatgccggcattgagctccaccatgactgagggaaagattgtttct
tgggtgaaatcagagggagataagctttctaagggtgaaagtgttgttgttgttgagtct
gataaggctgacatggatgttgagactttctatgatggttacttggctgctattatggtt
gaagaaggcggagttgctgccgtgggttctgctattgctttattggctgagactgaggag
gaaattgcggaggccaggtccaaagcctcgtcgtcgtcatcatcagctgctcagccagca
tctactagtagtagtgctccggaaccgtcgcagactgagaaaattgcggagcctgcggga
cctgcaatttcaaaggcggcagcaattgtgggatctgctgtgcacccggcatcagaggga
gggaaaagagtagtggcttcgccttatgcgaagaagcttgccaaggagttaaaggtggag
ctggagagagtagtgggtagtggacctatgggtagaattgtggctaaggatgttgaggct
gctgcctccgccgctgatgccgctgctagcttggctcctaaggtaggaaccaccgtaaat
ccgccgtctgggattgagttggggacggtggtgccatttacaacaatgcagggggcagtt
agtaggaatatggtggagagtttggcagttcctacatttagagttggctacactattact
actgatgcacttgatgctctttacaagaagatcaagtctaagggagtgaccatgacagcc
ttgctcgcaaaggctacagcccttgcgttggttaagcatcctgtaataaattccagttgt
agagatggtaaaagctttacgtataatagtagcatcaacattgcagttgctgtggccatg
gatggtggattgctcacgccagtgcttcaagatgctgataaggttgacatttattcactg
tcaagaaaatggaaagagttagttgataaggcccgggccaagcagctgcaacctcatgaa
tacaatacaggtactttcacgctttctaaccttggaatgtttggtgtggatcggtttgat
gccattctgccacctggaactggagcaatcatggctgttggtgcatctcagccaactgtt
gtggcaaccaaggatggccgtattggcatgaagaaccagatgcaggtaaatgttacagca
gatcatcgtgtaatctatggtgctgatctggcatccttcttgcaaaccctggcaaagatt
attgaggaccccaaagatcttaccttctag

DBGET integrated database retrieval system