KEGG   Hevea brasiliensis (rubber tree): 110637177Help
Entry
110637177         CDS       T05150                                 

Definition
(RefSeq) probable glutathione S-transferase parC
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hbr  Hevea brasiliensis (rubber tree)
Pathway
hbr00480  Glutathione metabolism
hbr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hbr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    110637177
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hbr02000]
    110637177
Enzymes [BR:hbr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     110637177
Transporters [BR:hbr02000]
 Other transporters
  Pores ion channels [TC:1]
   110637177
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_C_2 GST_C GST_N_2 GST_C_5 GST_N_4 GST_C_3 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 110637177
NCBI-ProteinID: XP_021642847
LinkDB All DBs
Position
Unknown
AA seq 221 aa AA seqDB search
MSKGEEVVLLDFWASPFCMRVKIALGEKGVTFESREEDLFGGKSELLLKSNPIYQKVPVF
LHNGKPLCESSVIVSYIDETWASPALLPPCTYGRAQARFLADYIDQKLFDAVRNVAMSKG
EATEAAKKELIEILKVVDGSLGDKDFFGGKTFGFIDIIAIPFTSWFLAAEKMGNFQVEAE
FPKVSGWIKRCMQRESVAKIIPDPEKIYEFVLMFRKKNGID
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaagggagaggaggtggttcttttggatttctgggccagccctttctgtatgagg
gtaaaaattgcgttgggtgagaagggggttaccttcgaatcaagagaggaggatttgttt
ggtgggaagagtgagttgttgctgaaatcaaacccaatttaccagaaggtgcctgtgttt
ttgcacaatggaaagccactctgtgagtcctccgttattgtcagttatattgatgagaca
tgggcttcacctgcactgcttccaccatgtacttatggacgtgctcaagctcgcttcttg
gctgattacattgaccaaaagctatttgatgcagttcgaaatgtggcgatgagcaaaggg
gaggccacagaggcagcaaagaaggagttgatagagatattgaaggtggtagatggaagc
cttggagataaagatttctttggagggaagacttttggatttattgacattatagcaatt
ccttttaccagttggtttttggctgctgagaaaatgggaaacttccaggttgaagctgaa
ttcccaaaggtttcaggctggataaagagatgcatgcaaagagagagtgttgccaaaatc
attcccgaccctgaaaagatctatgaatttgtgctcatgtttaggaagaagaatgggatt
gattag

DBGET integrated database retrieval system