KEGG   Hevea brasiliensis (rubber tree): 110645727Help
Entry
110645727         CDS       T05150                                 

Definition
(RefSeq) hexokinase-1-like
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
hbr  Hevea brasiliensis (rubber tree)
Pathway
hbr00010  Glycolysis / Gluconeogenesis
hbr00051  Fructose and mannose metabolism
hbr00052  Galactose metabolism
hbr00500  Starch and sucrose metabolism
hbr00520  Amino sugar and nucleotide sugar metabolism
hbr01100  Metabolic pathways
hbr01110  Biosynthesis of secondary metabolites
hbr01200  Carbon metabolism
Module
hbr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
hbr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:hbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110645727
   00051 Fructose and mannose metabolism
    110645727
   00052 Galactose metabolism
    110645727
   00500 Starch and sucrose metabolism
    110645727
   00520 Amino sugar and nucleotide sugar metabolism
    110645727
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    110645727
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hbr04131]
    110645727
Enzymes [BR:hbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     110645727
Membrane trafficking [BR:hbr04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    110645727
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 110645727
NCBI-ProteinID: XP_021654662
LinkDB All DBs
Position
Unknown
AA seq 494 aa AA seqDB search
MEKKVVLAVVCAAAVAGTVTAAIGVNRKMGKDGRWARAIEIVKEMEEKCATPIGKLKQVA
DAMVVEMHAGLASEGGSKLKMLISYVDNLPTGDENGLFYALDLGGTNFRVLRMQLGQEDG
RIVNQEFAEVPIPPNLMTGTSDALFDYIAAELAKFVSQEGEEFQLPPGKKRELGFTFSFP
VTQTSIASGTLVRWTKGFSIDDAVGQDVVAELTKAMERQGVHMHVSALVNDTVGTLAGGK
YFHKDVIAAVILGTGTNAAYVERAHAIPKWHGALPESGEMVINMEWGNFRSSHLPLTEYD
LELDVESLNPGEQIFEKIISGMYLGEIVRRVLLKMAEEAAFFSETVPAKLKVPFILRTPD
MSAMHHDTSSDLKVVGNKLKDILEISNTSLKTRKVVVELCNIVATRGARLAAAGILGILK
KMGKDKVKVGDKQRTMIALDGGLYEHYSEYSKCMENTLNELLGEEVSKSIEIVHSNDGSG
IGAALLAASHSQYR
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggagaagaaggtggtcttggctgtggtgtgtgccgccgctgtggctgggactgttacg
gcagcgatcggcgtcaatcgaaaaatggggaaggatggtagatgggccagagcaattgaa
atagtcaaagagatggaggagaaatgtgccacccctattggaaagctgaagcaggttgct
gatgccatggttgtggagatgcatgctggtcttgcctctgaaggtggaagcaagcttaag
atgctcatcagctatgtcgataatttgcctaccggtgatgagaatggattgttttatgca
ttggatcttgggggaacaaacttccgtgtattgcggatgcaacttgggcaggaggatggt
cgtattgttaatcaagaatttgcagaggtgcctattcctcctaatttgatgactgggact
tctgatgcactgttcgactatattgcagcagaacttgcaaaatttgtatctcaagaaggt
gaagagtttcaacttcctcctggtaaaaagagggaattgggtttcacattctcattccct
gttacgcaaacatccattgcttctgggactcttgttaggtggacaaaaggcttctcaata
gatgatgcagtcggccaagatgtcgtagcggaattaaccaaagctatggaaaggcagggt
gttcatatgcacgtgtcagctctggtcaatgatacagttggaaccctagctggaggcaaa
tacttccacaaggatgttattgctgccgtgattttaggtactgggacaaatgctgcttat
gtggaacgtgcacatgcaataccaaaatggcatggtgccctacctgaatctggcgagatg
gttatcaatatggagtggggtaactttaggtcgtcacatcttccactaactgagtatgac
cttgagttggatgttgaaagtttaaatcctggtgaacagatctttgagaagataatttct
ggcatgtacttgggagaaattgtacgcagagttctactaaagatggctgaagaagctgct
tttttcagtgaaactgttcctgcaaaacttaaagttccttttatattgagaacgccggat
atgtcagcaatgcatcatgatacatcctctgatcttaaagtggtgggaaataaattgaag
gatattttagagatatccaacacctcactgaaaacaagaaaagttgttgttgagctctgc
aacattgttgccacccgtggagcacgactggcagcagcaggaattttggggatcctaaag
aaaatggggaaggataaagtcaaagtgggggataaacagaggacaatgatagccttggat
ggtggattgtatgagcactatagtgaatatagcaagtgcatggagaatactcttaatgaa
ttgcttggagaagaagtgtcaaaaagcattgagattgtgcactctaatgatggatctgga
attggagctgctctacttgctgcctcgcattcacagtatcgttga

DBGET integrated database retrieval system