KEGG   Hevea brasiliensis (rubber tree): 110646036Help
Entry
110646036         CDS       T05150                                 

Definition
(RefSeq) very-long-chain 3-oxoacyl-CoA reductase 1-like isoform X1
  KO
K10251  17beta-estradiol 17-dehydrogenase / very-long-chain 3-oxoacyl-CoA reductase [EC:1.1.1.62 1.1.1.330]
Organism
hbr  Hevea brasiliensis (rubber tree)
Pathway
hbr00062  Fatty acid elongation
hbr01040  Biosynthesis of unsaturated fatty acids
hbr01100  Metabolic pathways
hbr01110  Biosynthesis of secondary metabolites
hbr01212  Fatty acid metabolism
Module
hbr_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hbr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    110646036
   01040 Biosynthesis of unsaturated fatty acids
    110646036
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hbr01004]
    110646036
Enzymes [BR:hbr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     110646036
    1.1.1.330  very-long-chain 3-oxoacyl-CoA reductase
     110646036
Lipid biosynthesis proteins [BR:hbr01004]
 Fatty acid synthase
  Component type
   110646036
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR NAD_binding_10 3HCDH_N
Motif
Other DBs
NCBI-GeneID: 110646036
NCBI-ProteinID: XP_021655026
LinkDB All DBs
Position
Unknown
AA seq 267 aa AA seqDB search
MELLDVIVITFSYLGFVSLCKNIVRFCRWVWVMFLRPPKNLKESYGSWAVVTGSTDGIGK
ALAFELASKGLNLVLVGRNPSKLEATAKEIRARNGKNNDQLQIKTSVIDLARSNGEEISR
AIEECIEGLDIGVVINNAGLAYPYSRFFHEVDLELMESIIKVNAEAATWVTRSVIPVMLK
KKKGAIVNIGSASSVAIPSYPLNAIYASTKAYAFPSFFTFVVPKYERNQFNSLLPYILYK
KNQEIQGCLNCLLFSLIFNSFGVIASV
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggaattgctagatgtcatcgtaataaccttcagttacctaggtttcgtttctctctgc
aaaaatattgtgagattttgcaggtgggtatgggtcatgttcttgaggccaccaaagaat
ttgaaggaatcctatggttcatgggcagtagtcactggttccactgatggaattggcaag
gctcttgcattcgagctcgcatcaaagggtctgaatctagttctggtgggtcgaaaccct
tcgaaacttgaagctacagctaaagaaatacgagcaagaaatggcaagaataatgatcaa
ctgcagataaaaacaagcgtcatagatcttgcaaggtctaatggagaggagatatcaagg
gcaatagaggagtgtattgaagggttagatattggtgttgtgataaataatgcaggattg
gcctacccttattccaggttctttcatgaggttgatttggagctgatggaaagcattatc
aaggtgaatgcagaggcagcaacttgggtcactaggtcagtgattcctgtgatgttgaag
aagaagaaaggtgcaatcgttaatattgggtctgcatcatctgtagccatcccttcgtac
ccattaaatgccatctatgcctccaccaaagcgtatgctttcccttcctttttcactttt
gttgtgcccaaatatgaaagaaatcaatttaattcattattgccctatattctttacaag
aaaaaccaagaaatacaaggatgtttgaattgtttgctgttttctttgatattcaattct
tttggagtaattgctagtgtttga

DBGET integrated database retrieval system