KEGG   Hevea brasiliensis (rubber tree): 110647677Help
Entry
110647677         CDS       T05150                                 

Definition
(RefSeq) glutamate decarboxylase-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
hbr  Hevea brasiliensis (rubber tree)
Pathway
hbr00250  Alanine, aspartate and glutamate metabolism
hbr00410  beta-Alanine metabolism
hbr00430  Taurine and hypotaurine metabolism
hbr00650  Butanoate metabolism
hbr01100  Metabolic pathways
hbr01110  Biosynthesis of secondary metabolites
Module
hbr_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:hbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    110647677
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    110647677
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    110647677
   00430 Taurine and hypotaurine metabolism
    110647677
Enzymes [BR:hbr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     110647677
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 110647677
NCBI-ProteinID: XP_021657314
LinkDB All DBs
Position
Unknown
AA seq 499 aa AA seqDB search
MVIASTIAADSDALLHSTFASRYVRAPVPRFKMPEKSMPKEAAYQVINDELMLDGNPRLN
LASFVTTWMEPECNDLIMASMNKNYVDMDEYPVTTELQNRCVNMIAHLLHAPVGDDETAI
GVGTVGSSEAIMLAGLAFKRKWQNKRKAEGKPYDKPNIVTGANVQVCWEKFARYFEVELK
EVKLTEGYYVMDPVKAVEMVDENTICVAAILGSTLTGEFEDVKLLNELLTKKNEETGWNT
PIHVDAASGGFIAPFVCPDLLWDFRLPLVKSINVSGHKYGLVYAGVGWVIWRAKEDLPEE
LIFHINYLGSDQPTFTLNFSKGSSQIIAQYYQFIRLGFEGYKRVIENCMENTRVLKEGLE
KTGRFDIVSKDVGVPLVAFSLKDSSKYSVFDIAENLRRFGWIIPAYTMPADAQHIAVLRV
VVREDFSRSLAERLVSHIEQVLKEMDSLPVHVSTTTATVREKLENTEGKKVVKKSEREIQ
EEITRYWRRLADGKRIGVC
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggtcatcgctagcaccattgctgccgactccgatgcgcttctgcactccacttttgct
tccagatatgttcgcgctcctgttccaaggtttaagatgccagagaagtcgatgcccaag
gaagcagcgtatcaggtgatcaatgatgagctgatgctggatgggaatccaaggcttaac
ttggcttcttttgtcaccacttggatggagcctgagtgcaatgatctcattatggcttct
atgaacaagaattatgttgatatggatgagtaccctgttaccactgagctccagaatcgg
tgtgtgaatatgatagctcacctgctccatgctcctgttggagatgatgaaactgcaatc
ggcgtggggactgtgggatcatctgaggcaataatgctggctggattagcttttaaaagg
aagtggcagaacaagagaaaggcagagggcaaaccatatgataagcccaacattgtgact
ggagctaatgtgcaagtctgctgggagaaatttgcaaggtactttgaagttgaactgaag
gaggtgaagctgacagagggatattatgtgatggaccctgtgaaggcagttgagatggtg
gatgagaatacaatctgtgttgcagccattttgggatcaaccctgacaggagagtttgaa
gatgtgaagcttcttaacgaactactcactaaaaagaatgaggagaccggatggaacacc
ccaattcatgttgatgctgccagtggaggcttcattgctccttttgtttgcccagatctt
ctatgggacttccgtttgccattggtgaagagtattaatgtaagtgggcataagtatggc
cttgtttatgctggtgttggttgggtcatctggagagctaaagaagacttgccggaggag
cttatatttcacattaactaccttggatctgatcaacccactttcactctaaacttctca
aaaggctctagtcaaattattgctcaatattatcagtttataaggcttggttttgagggt
tataagagagtcattgaaaactgtatggaaaatacaagggtgctgaaagaaggactagag
aaaacagggcgatttgacattgtctccaaagatgttggtgtgcctcttgttgccttctct
ctcaaagacagcagtaaatacagtgtgtttgatatagctgagaatttgagaaggtttggc
tggattattccagcatacacaatgccggcagatgcccagcacattgctgttcttcgggtt
gtggtcagggaggatttcagccgcagtctggcagaaagactcgtctcgcatatcgagcaa
gttttgaaggaaatggactctcttcctgtccatgtttccaccacaactgctactgttagg
gaaaaactggagaacactgaagggaagaaggtagttaaaaagagtgagagggagatacag
gaagagatcactcggtattggaggcgacttgcggatggcaagagaattggagtgtgctag

DBGET integrated database retrieval system