KEGG   Hevea brasiliensis (rubber tree): 110647904Help
Entry
110647904         CDS       T05150                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase SDP6, mitochondrial-like
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
hbr  Hevea brasiliensis (rubber tree)
Pathway
hbr00564  Glycerophospholipid metabolism
hbr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hbr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    110647904
Enzymes [BR:hbr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     110647904
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 Pyr_redox_2 NAD_binding_8 GIDA Pyr_redox Pyr_redox_3 HI0933_like
Motif
Other DBs
NCBI-GeneID: 110647904
NCBI-ProteinID: XP_021657631
LinkDB All DBs
Position
Unknown
AA seq 631 aa AA seqDB search
MPSPTSLRRLGAVAVVTTAAAVTGGSILFSPNLATNDRGGGPALDSFRQKITDPNAVVPS
RAAQESVLTGTSAANPLDVLVIGGGATGCGVALDAVTRGFRVGLVEREDFSSGTSSRSTK
LIHGGVRYLEKAVFNLDYGQLKLVFHALEERKQVIDNAPHLCHALPCMTPCFDWFEVVYY
WMGLKMYDLVAGPRLLHLSRYYSAQESLELFPTLAKKGKDRSLRGTVVYYDGQMNDSRLN
VALACTAALAGAAVVNHAEVVSFLKDEANERIIGTRIRDNLSGKEFDAYAKVVVNAAGPF
CDSVRKMAKNDAQPMICPSSGVHVVLPDYYSPEGMGLIVPKTKDGRVVFMLPWLGRTVAG
TTDSNTTITLLPEPHEDEIQFILDAISDYLSVKVRRTDVLSAWSGIRPLAIEPSTKNTES
ISRDHVVCEDYPGLVTITGGKWTTYRSMAEDAVDAAIKSGKLSPTNGCLTQNLRLIGGDG
WEPSSFTVLAQQYVRMKRTYGGKVVPGVMDTATAKHLSHAYGTLAERVAAIAQNEGLGKR
LAHGYPFLEAEVAYCARNEYCGSVVDFIARRSRLAFLDTDAAGRALPRVIEILANEHSWD
KARQKQELEKAKRFLETFKSSKNAQFHDGKH
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgccctccccgaccagtttacgccgtctcggcgccgtcgctgttgtcaccactgctgcc
gccgtgaccggaggctccatcctcttctcccccaacctagccaccaacgaccgaggcggt
gggcctgctctcgactcctttaggcagaaaattactgatcccaacgctgtcgttccttct
cgagcagctcaggagtcggttttgactggcacaagtgccgctaatccccttgatgttctc
gtgatcggcggtggcgccaccggctgtggagtggcgctcgatgctgtcacaaggggattt
cgcgttggtctagttgagagagaggacttctcttctggtacctcttcaaggtccacgaag
ctaattcatggaggagttcgctatttggagaaagcagtgtttaatcttgactatggtcaa
ctgaagttagttttccatgcacttgaggaacggaaacaggttattgacaatgcgccacat
ctgtgccatgctttgccttgcatgacgccctgttttgactggtttgaggtggtatactat
tggatgggcctgaaaatgtatgatttggtcgcaggaccacgcttgttacacttgtccaga
tattattctgcacaagagtcccttgaattgtttccaactcttgcaaaaaagggtaaagat
agaagcttgaggggcacagtggtgtattatgatgggcagatgaatgactcaaggcttaat
gttgctttggcatgtactgctgcattagctggtgcagcagtggtcaaccatgcagaagtg
gtatctttcctaaaagatgaggctaatgagcggataattggcacacggattcgggacaat
ttatcaggcaaagagtttgatgcctatgcaaaagttgtcgtgaatgcggccggcccattt
tgtgactctgtaaggaaaatggctaagaatgatgcacaacctatgatctgtcctagcagt
ggtgtacatgttgttctccctgattattattctccagagggaatgggtttgattgttcct
aaaacaaaagatggacgtgttgttttcatgctgccatggttgggaagaacagtcgctgga
actacagattctaacactaccatcactttgcttccagaaccacatgaggatgaaattcag
tttatacttgatgctatctcagattaccttagtgttaaggtacgccgcacagatgttctt
tcagcctggagtggtattcgcccattagctattgagccatcaacaaaaaatactgagagc
atctccagagatcatgttgtatgtgaagattatcctggtttggtcacaatcacaggtgga
aaatggactacttaccgaagcatggcagaagatgctgttgatgcagctataaagtctgga
aaactaagtccaacaaatggatgtttaactcaaaacctcaggctgattggtggagatggc
tgggagccttcatcattcactgttcttgctcaacaatatgtacgcatgaagaggacatat
ggtggtaaagttgtccctggagtaatggacacagctactgctaagcatttatcacatgca
tatggtacattggcagaacgagtggctgctatagctcagaatgaaggtctagggaagcgg
cttgcccatggctacccttttctagaagcagaggttgcctactgtgctcgaaatgagtac
tgcggatctgttgttgatttcattgctaggagatcacggcttgcattcctggatactgat
gcagcgggccgagcattgccacgtgtaattgagatactggctaatgagcacagttgggat
aaggcaaggcagaagcaagagttagagaaggccaaaagatttttggaaactttcaagtcg
tcaaaaaacgctcagttccacgatgggaaacattaa

DBGET integrated database retrieval system